KEGG   Cronobacter turicensis: CTU_39680Help
Entry
CTU_39680         CDS       T00999                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00250  Alanine, aspartate and glutamate metabolism
ctu00410  beta-Alanine metabolism
ctu00640  Propanoate metabolism
ctu00650  Butanoate metabolism
ctu01100  Metabolic pathways
ctu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CTU_39680 (puuE)
   00650 Butanoate metabolism
    CTU_39680 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTU_39680 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CTU_39680 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctu01007]
    CTU_39680 (puuE)
Enzymes [BR:ctu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CTU_39680 (puuE)
Amino acid related enzymes [BR:ctu01007]
 Aminotransferase (transaminase)
  Class III
   CTU_39680 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBA34292
UniProt: C9Y2E3
LinkDB All DBs
Position
complement(4120334..4121626)
Genome map
AA seq 430 aa AA seqDB search
MTFISRRMRVKNSELNQRRQSATPRGVGVMCGFYAEKADNATLWDVEGNEIIDFAAGIAV
LNTGHRHPRVVEAIENQLRAFTHTAYQIVPYESYVSLAERINDCAPIDGPAKTAFFTTGA
EAVENAVKIARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYP
NALHGVSVDDAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMEALRALCDEH
GILLIADEVQSGFARTGKLFAMEHYSVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPG
GLGGTYAGNPLAVAAAHAVLDVIEQENLCQRANELGQHLQEVLNQARTYCPAIAEVRGQG
SMVAVEFNDPQTGKPSPAFTQDVLTRAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKA
LEILSRALGR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtttatcagcaggagaatgcgggtgaaaaattcagaattgaaccaacgtcgtcag
agcgccaccccacgcggcgtcggcgtcatgtgcggcttctatgccgaaaaagccgacaat
gccaccctgtgggacgtggaaggcaacgagattatcgatttcgcggcagggatcgcggtg
ctgaacactggtcatcgccatccacgcgtggtggaggctatcgaaaatcagctgcgcgcc
tttacgcacacggcttatcagatagtcccttacgaaagctatgtgtcgcttgcggagcgt
attaacgactgcgcgccgattgacggcccggcgaaaaccgcgttcttcactactggcgcg
gaagcggtggaaaacgccgtgaaaatcgcgcgcgcgtatacccgtcgccccggcttaatc
accttcggcggcggcttccacggacgcacgtttatgacgatggcgctcaccggcaaagtg
gcgccatacaaaatcggcttcggcccgttccctgggtcggttttccacgcgcaatacccg
aacgcgctgcacggcgtgtcggtggatgacgcgatggcgagcctggagcgtattttcaaa
gccgatatcgcaccggatcaggtggcggccatcgtgctggagccggtacagggcgaaggc
ggttttaacgtcgcgccgcctgcgtttatggaggcactgcgcgcgctgtgcgacgagcac
ggcattctgttgattgccgatgaagtgcagagcggctttgcgcgcaccggcaaactcttt
gcgatggagcattacagcgtgaagccggatctgctgacgatggcgaaaagcctcgcgggc
ggtatgccgctctcgggcgtggtggggcgcgcggaagtgatggacgcgcctgcgccgggc
ggccttggcggcacctacgccggcaacccgctggcggtcgcggcggcgcacgcggtgctg
gatgtgattgagcaggaaaacctgtgccagcgcgcgaacgagctgggccagcatctgcag
gaggtgctcaaccaggcgcggacgtattgcccggcgattgccgaggtacgtgggcagggc
tcgatggtggcggtggagtttaacgatccacaaaccggcaagccgtcgccggcgtttacg
caggacgtgctgacgcgcgcccgcgaagaggggctgctgctgctgagctgcggcgtttac
ggcaacgttatccgtttcctttatccgctgaccatcccggatgcgcagttcagtaaagcg
ctggagatcctctcgcgcgcgctggggcgttga

DBGET integrated database retrieval system