KEGG   Chlamydia trachomatis G/9301: CTG9301_00285Help
Entry
CTG9301_00285     CDS       T01906                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
ctv00020  Citrate cycle (TCA cycle)
ctv00310  Lysine degradation
ctv01100  Metabolic pathways
ctv01110  Biosynthesis of secondary metabolites
ctv01120  Microbial metabolism in diverse environments
ctv01130  Biosynthesis of antibiotics
ctv01200  Carbon metabolism
Module
ctv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTG9301_00285 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CTG9301_00285 (sucA)
   00380 Tryptophan metabolism
    CTG9301_00285 (sucA)
Enzymes [BR:ctv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTG9301_00285 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C
Motif
Other DBs
NCBI-ProteinID: ADH96688
LinkDB All DBs
Position
60946..63663
Genome map
AA seq 905 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQVFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSIAVETLNCSPEIQEYIWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGQKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQM
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDILACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNESDDPFVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSDELERIDTEIAH
VLNQEYASLKDPGVERLDKKECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEH
FSPHAKIRSLLNKRMSMADGAIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQ
LVWTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFG
DFSNGAQIIFDQYISSGIQKWDLHSDVIVLLPHGYEGQGPEHSSARIERYLQLASDWNFQ
VVLPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDE
NPNYHAKVLVLCSGKIYYDYRASLPKDLECRFACIRVESLYPLYLEDLLVLISKYTEVHH
YVWLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSTLMETLF
SIGRE
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaggttgggaagacggaggggagcccaacagaatcttctcatgatcaagtctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatcgctgttgag
acattgaattgctctcctgagatccaagaatatatctggaaactcatggaaggagagaag
ccctctttaaccaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggacaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgtcggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagatg
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatattttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaagtgacgatccttttgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccgacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagataaaaaa
gaatgtatgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggataca
tcgttagacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcat
ttttctcctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatgga
gcgatcggttatgattggggaatggctgaagaggtggcgttcgcttctttattacaagaa
ggtttttcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacag
ttagtctggacggatgtccagacaggggatacattctctccattatatcacttgtctccg
agtcaaggcagcgtggaattatacaattcccctctatctgaatacgccgttttaggcttt
gaatatggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttgga
gacttttccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaa
tgggatttacattccgatgtaattgtactgcttcctcatggctatgaggggcaaggacct
gagcattcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaa
gttgttcttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagaga
gacctctctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgc
gtgagttctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgag
aatcctaactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactat
cgtgcttctcttcctaaagatcttgaatgtcgttttgcttgtatacgagtagagagtttg
tatccgttatacttagaagatctattggttctgataagcaaatatacggaagttcaccat
tatgtatggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagca
actgacgagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacg
gcaacaggatctgcgagtttaagtcaaaaagaattatcgacgttaatggaaaccttgttt
tctataggtagagagtag

DBGET integrated database retrieval system