KEGG   Chlamydia trachomatis G/9301: CTG9301_00680Help
Entry
CTG9301_00680     CDS       T01906                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
ctv  Chlamydia trachomatis G/9301
Brite
KEGG Orthology (KO) [BR:ctv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CTG9301_00680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR HTH_24
Motif
Other DBs
NCBI-ProteinID: ADH96765
LinkDB All DBs
Position
complement(149125..150402)
Genome map
AA seq 425 aa AA seqDB search
MLRPPSFLKKLLSSVRNNFIIKSILKAPKVLYHNEASKEACVLSYYGLFSCVPILVFFLR
LSQYLFISLDWKEWLLLHFPDYKAPILAIIEAAYSTTSNIGVVLVSSFFVFCWAGILMLQ
SLEDGLNKIFCSGITQASLKRLISYLVITLVSPMIFIIVCGSWIYITQILPINYPQLFSF
SHSMAFIYIVSRLLPYALLYGILFCCYAFLSRVPTKKSAAFFAATIAGSAWILSQKIFFC
LQLHLFNYSFTYGALVALPSFLLLLYLYAIIYLFGGALTFLFQNKGFSILIPKEEIFPSS
YFKFILCVYVLSLITEHFDNALPPPSANYLANKAKASIGETSQCLDILEREGMILKYKEG
YKPSHNIANLHINTIFDQLTKSPAFSKICSPSLIPIQDALTHILTEIKKNSHNLSLSEIA
KKVNS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccctccgtcttttcttaaaaagcttctctcttctgttcgcaacaatttcatc
atcaaatctatcctaaaagctcctaaagttctttatcacaacgaggcttctaaagaagcc
tgcgttctaagctattatggactattcagttgtgttcctatattggtcttcttcctcagg
ctttctcaatacctattcattagtttagactggaaagagtggttactcctccactttccc
gattacaaagcgccgatcttggcaattattgaagcagcttactcaacaactagcaatatc
ggagtggttcttgtcagtagtttctttgtcttctgctgggcaggtattctgatgctacaa
tctttagaagatgggctaaataaaatcttctgttcaggaatcactcaagcttctttaaag
agactaattagctatctagttatcactcttgttagccccatgatctttattattgtttgc
ggatcttggatctatattacacagattctacctatcaactacccccaactatttagtttc
agccattccatggcttttatttacattgtttcacgattacttccctatgctcttctgtac
gggattctcttttgttgctatgcattcctctctagagtccccaccaagaaatctgcagct
ttttttgcagcaactatagctggtagtgcatggatcctctctcaaaaaatcttcttttgc
ctccagctccacctttttaattatagcttcacttacggagctctagttgctttaccctct
tttcttctccttctttacctctatgctattatctatttgtttggaggagccttaaccttc
ttattccaaaacaaaggttttagcattttaatccctaaagaagaaattttcccaagtagc
tatttcaagttcattttatgtgtgtatgttctttccctaatcacagaacactttgataat
gctctccctcctcccagtgcaaactatcttgctaacaaagccaaagcttctattggagaa
acctctcaatgtttagatattttagaaagagagggtatgattcttaaatacaaagagggc
tataagccttctcataacattgcgaaccttcatatcaacaccatcttcgatcagcttact
aagtcccctgctttttctaaaatctgctccccctctcttattcctatacaggatgcgctg
actcatatacttactgaaatcaaaaagaactcgcataacctttccctttcagaaattgct
aaaaaagtgaattcatga

DBGET integrated database retrieval system