KEGG   Chlamydia trachomatis G/9301: CTG9301_01900Help
Entry
CTG9301_01900     CDS       T01906                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
ctv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctv01100  Metabolic pathways
ctv01110  Biosynthesis of secondary metabolites
ctv01130  Biosynthesis of antibiotics
ctv01230  Biosynthesis of amino acids
Module
ctv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ctv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTG9301_01900
Enzymes [BR:ctv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CTG9301_01900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 KTI12 6PF2K
Motif
Other DBs
NCBI-ProteinID: ADH97005
LinkDB All DBs
Position
419948..420502
Genome map
AA seq 184 aa AA seqDB search
MPTFDTTKQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHGDSPKTIYQRYGE
EGFCREEFLALTSVPVIPSIVALGGCTPIIEPSYAHILGRNSALLVLLELPIATLCQRLQ
HRSIPERLAHAPSLEDTLSQRLDKLRSLTSNAFSLRAETSSEAVMRDCQSFCLRFLSTKE
SSYA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgttcgacactaccaagcagattttcctttgcggtcttccttctgtaggtaaa
acctcgtttggtcaacatttatcgcaatttctatcgctgcctttttttgatacagatcac
cttctttcagatcgtttccatggagattctcctaaaactatctaccaacgctatggagaa
gaaggtttttgcagagaagaattccttgccctaactagtgtacctgtcattcctagcatc
gtagctttaggaggctgtacccctattattgaaccatcttacgcccatattttggggaga
aacagtgctctcttagtcttactcgaactccccatcgctacactatgtcaacgcctacaa
catagatctattcctgaaagacttgcacatgctccatcattagaagatactttgtctcaa
cgattagacaaactacgatccctcacatcaaatgccttctctttacgagcagagacttcc
tctgaagctgtgatgagagattgtcaaagcttttgtttgcgttttttgagcacaaaagag
agctcctatgcataa

DBGET integrated database retrieval system