KEGG   Hungateiclostridium thermocellum DSM 1313: Clo1313_0022Help
Entry
Clo1313_0022      CDS       T01933                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ctx  Hungateiclostridium thermocellum DSM 1313
Pathway
ctx00010  Glycolysis / Gluconeogenesis
ctx00020  Citrate cycle (TCA cycle)
ctx00620  Pyruvate metabolism
ctx00633  Nitrotoluene degradation
ctx00640  Propanoate metabolism
ctx00650  Butanoate metabolism
ctx00680  Methane metabolism
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01120  Microbial metabolism in diverse environments
ctx01130  Biosynthesis of antibiotics
ctx01200  Carbon metabolism
Module
ctx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_0022
   00020 Citrate cycle (TCA cycle)
    Clo1313_0022
   00620 Pyruvate metabolism
    Clo1313_0022
   00640 Propanoate metabolism
    Clo1313_0022
   00650 Butanoate metabolism
    Clo1313_0022
  09102 Energy metabolism
   00680 Methane metabolism
    Clo1313_0022
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1313_0022
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1313_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C OxoGdeHyase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADU73122
LinkDB All DBs
Position
22927..24111
Genome map
AA seq 394 aa AA seqDB search
MGIRERLSGNEATAIAMRQINPDVVAAFPITPSTEIPQYFSSYVADGLVDTEFVAVESEH
SAMSACIGAQAAGARAMTATSANGLAYMWEALYIAASMRLPIVLAAVNRALSGPINIHND
HSDTMGARDSGWIQLYSENNQEAYDNMLMAHRIGEHPDVMLPVMVCQDGFITSHAIENIE
LVEDEKVKAFVGEYKPTHYLLDRENPISVGPLDLQMHYFEHKRQQAQAMENAKKVILEVA
EEFYKLTGRKYGFFEEYKTDDADVAIVVMNSTAGTVKYVIDEYRVKGKKVGLIKPRVFRP
FPVDELAQALSKFKAVAVMDKADSFNAAGGPLFTEVTSALFTKGVFGPKVINYKFGLGGR
DVKVDDIEVVCEKLLEIASTGKVDSVYNYLGVRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagagaaaggcttagcggtaatgaggcaacggcgattgccatgagacaaata
aatcctgatgtggttgctgcttttccgataacaccgtcaacggaaattcctcaatatttc
tcgtcatatgtcgctgacggacttgtagatacggaatttgttgctgtggaatcagagcac
agtgcaatgtctgcatgtataggtgctcaggctgcaggtgcaagagcaatgactgccaca
tccgcaaacggtttggcatatatgtgggaggctttgtatatagcggcaagtatgagactt
ccgattgtattggcggctgtaaacagagcactttcaggtcctatcaatatccacaacgac
cacagcgatacaatgggagctagggattcgggatggatccagttatacagtgaaaacaac
caggaggcttatgacaacatgcttatggctcacaggataggtgagcatcctgatgtaatg
cttcctgtcatggtctgccaggacggatttattacttctcacgcaatagaaaatattgaa
ctggtggaagatgagaaagttaaggcttttgtaggagaatacaaaccgactcattatctt
ctcgacagggaaaatccgatttctgtgggtcctttggatttgcagatgcattatttcgag
cacaagagacagcaggcacaggcaatggaaaacgccaaaaaggtaattcttgaagtggcg
gaagaattctacaagcttacgggaagaaaatacggattttttgaagaatacaaaaccgat
gatgccgatgttgccattgttgttatgaactccactgccggtactgtaaaatatgttatc
gacgagtacagggtaaaaggcaaaaaagttggtttgataaaacctagagtattcagacct
ttccctgttgatgaactggcacaggctttgtcaaagtttaaggcagtggccgttatggac
aaggctgacagcttcaatgcagccggaggacctttgtttacagaggtaacaagtgcactc
ttcacaaaaggagtatttggtcctaaggttattaactataagtttggattgggtggaaga
gacgttaaagttgatgatattgaagttgtttgtgagaagcttctggaaattgcaagtaca
ggcaaggtagactcagtatacaattaccttggtgttagagagtag

DBGET integrated database retrieval system