KEGG   Hungateiclostridium thermocellum DSM 1313: Clo1313_0288Help
Entry
Clo1313_0288      CDS       T01933                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ctx  Hungateiclostridium thermocellum DSM 1313
Pathway
ctx00473  D-Alanine metabolism
ctx01100  Metabolic pathways
ctx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clo1313_0288
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Clo1313_0288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctx01011]
    Clo1313_0288
Enzymes [BR:ctx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clo1313_0288
Peptidoglycan biosynthesis and degradation proteins [BR:ctx01011]
 Precursor biosynthesis
  Racemase
   Clo1313_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU73379
LinkDB All DBs
Position
313640..314815
Genome map
AA seq 391 aa AA seqDB search
MGMDYKFNRAWAEVNLDNIAHNVKEIRRIVDKKVEIMGVVKADAYGHGVMEIARTLLENG
VTRLAVSMLDEAIQLRQNGIKVPILILSYTDPVRAEEIVLNDVTQTVFSHDLAEALSEAA
VKHHRNVKIHIKIDTGMTRVGFMPGYSAVKNVVQISKLPGIIIEGLFTHFASADEADKSY
TYMQFERFMSIVGELNRIGVYIPVKHVCNSAALIEFPEMHLNMVRPGIALYGLYPSDEVD
KTKIDLRPAMSLKANVILVKDVEKDTFISYGRIFKTSRNSRIATIPIGYADGYTRLLTGK
GKVLLNGQLAPIVGRICMDQCMVDITDIEGDVKVGDEAVLIGKQKDNEIKVEDLAKSVGT
INYELVSIIGKRIPRVYLKEGKIYNVLNYLI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggactataaatttaacagggcatgggccgaggttaatctggacaacattgcc
cataatgtaaaggaaatcaggcgaattgttgacaagaaagttgagataatgggagtggtt
aaggctgacgcatacggacatggagtaatggagattgccagaacacttttggaaaacggt
gttacccgtctggcggtgtccatgctggatgaagccatacagcttcgtcaaaacggtatt
aaggttccgatattgatattaagctataccgaccctgtacgggcggaagagattgtttta
aacgacgtcacccagacggttttcagccatgatttggcggaagctctgtcggaggcggct
gtaaaacaccacagaaatgtaaagattcatatcaagatagataccggtatgacaagggtt
ggatttatgcccggttacagtgcggttaagaatgtggtgcagataagcaagctgccgggc
attattattgaaggattgtttacccattttgcatcggcggacgaggctgacaaatcctac
acctatatgcagtttgaaaggtttatgagcatagtcggcgaacttaacagaataggggtg
tatattcccgtaaagcacgtatgcaacagtgccgcgttgattgagtttcctgaaatgcac
ctcaacatggtaaggccgggtatagcattgtacggattgtatccttcggatgaggtggat
aaaaccaaaatcgacttaagaccggccatgtctttaaaggcaaatgtgatacttgtaaaa
gatgtggaaaaggacacctttatcagctacggaagaatatttaaaacgagccggaacagc
aggatagcaactatacccataggatatgccgacggatatacaaggcttcttaccggcaaa
ggaaaagtacttctgaacggtcagctggctcctattgtgggaagaatttgcatggatcag
tgcatggtagacataacggatattgaaggagacgtaaaagtcggagatgaagccgtgctt
atcggaaagcagaaagataacgaaataaaagtcgaggacctggcaaaaagtgttgggaca
ataaattacgaactggtaagcataataggaaagagaattcccagagtttacctgaaagaa
gggaagatatacaatgtattaaattatttgatataa

DBGET integrated database retrieval system