KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0319Help
Entry
Clo1313_0319      CDS       T01933                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ctx03012]
    Clo1313_0319
   03029 Mitochondrial biogenesis [BR:ctx03029]
    Clo1313_0319
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctx04147]
    Clo1313_0319
Translation factors [BR:ctx03012]
 Eukaryotic Type
  Elongation factors
   Clo1313_0319
 Prokaryotic Type
   Clo1313_0319
Mitochondrial biogenesis [BR:ctx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Clo1313_0319
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Clo1313_0319
  Exosomal proteins of breast cancer cells
   Clo1313_0319
  Exosomal proteins of colorectal cancer cells
   Clo1313_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADU73410
LinkDB All DBs
Position
350435..351637
Genome map
AA seq 400 aa AA seqDB search
MSKAKFERTKPHVNIGTIGHVDHGKTSLTAAITKVLGFQGKANYTSYENIDKAPEERERG
ITISTSHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEIRELLNTYEFPGDEIPIIRGSALAALE
STATSVDAPEYQPILKLMEEVDKYIPTPQRDSDKPFAMPVEDVFTITGRGTVATGRVERG
TLKMGDEVEIVGLSDSPKKTVVTGIEMFRKLLDQAVAGDNIGALLRGIQRNEVERGQVLA
KPGSIKPHTYFEAQVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGVVELPQGTEMVMPG
DHITMKVKLITPVAMEEGLKFAIREGGRTVGAGNVSKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagctaaatttgaaagaacaaaaccccacgttaatatcggaacgattggtcac
gttgaccatggtaagacatcattgactgcggctataacaaaagttttaggtttccagggt
aaggcaaactatacttcttatgaaaacatcgacaaagctccggaagaaagagaaagaggt
attacaatatcaacttcacacgttgagtatgaaactgataacagacactatgctcacgtt
gactgccctggtcatgccgactacgttaagaacatgatcacaggtgctgctcagatggac
ggtgctatacttgttgtatcagcagcagacggtccgatgccacagacaagagaacacatt
ttgttggctcgtcaggttggtgtgccatacatagttgttttcttgaacaagtgtgatatg
gtagatgacgaggaacttctcgaattggttgaaatggaaatcagagaactcctgaatact
tacgaattccccggagacgaaattccgataataagaggttcagcacttgctgctcttgaa
tcaacagctacttcagttgacgctccggaatatcaaccgattttgaaactcatggaggaa
gttgacaaatatattccgactcctcagagagatagtgacaaaccgtttgctatgcctgtt
gaagacgtattcacaattacaggtcgtggtactgttgctacaggtagagttgaaagagga
actcttaagatgggtgacgaagttgaaattgttggtttgtctgattctccgaagaaaaca
gttgtcaccggtatagaaatgttcagaaagcttcttgatcaggctgttgctggtgacaat
ataggagctctcctgagaggtattcagagaaatgaggtagaaagaggacaggttcttgca
aaacccggttcaatcaaacctcacacttattttgaagcacaggtttacgttttgacaaaa
gaagaaggtggaagacatactcctttcttcaacaactacagacctcagttctatttcaga
actactgacgttacaggagtagttgagcttcctcagggaactgaaatggttatgcccggt
gaccacataaccatgaaagtcaaattgataactcctgtagctatggaagaaggattgaag
ttcgctatccgtgaaggtggtagaactgtaggagcaggaaacgtatccaagataattgaa
taa

DBGET integrated database retrieval system