KEGG   Clostridium tyrobutyricum: CTK_C13130Help
Entry
CTK_C13130        CDS       T04331                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctyk  Clostridium tyrobutyricum
Pathway
ctyk00010  Glycolysis / Gluconeogenesis
ctyk00020  Citrate cycle (TCA cycle)
ctyk00620  Pyruvate metabolism
ctyk01100  Metabolic pathways
ctyk01110  Biosynthesis of secondary metabolites
ctyk01120  Microbial metabolism in diverse environments
ctyk01130  Biosynthesis of antibiotics
ctyk01200  Carbon metabolism
Module
ctyk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctyk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTK_C13130 (acoC)
   00020 Citrate cycle (TCA cycle)
    CTK_C13130 (acoC)
   00620 Pyruvate metabolism
    CTK_C13130 (acoC)
Enzymes [BR:ctyk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTK_C13130 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 Polo_box_3
Motif
Other DBs
NCBI-ProteinID: AND84574
UniProt: A0A4P8A189
LinkDB All DBs
Position
1285499..1286851
Genome map
AA seq 450 aa AA seqDB search
MSSLIVMPKLGLTMEEGEIETWHKGEGEEVKKGEILFDVTTDKLTNEVEAKESGVLRKIF
AQEGDTVKCLDPVAIIAGKNEDISGLLQEVNIDGDEIQPKETVSPVSDKNEMHEAESVPV
KREGRIKISPIAKKIALQNNVDFELITGTGPMGRIVKNDVEQYIESNRIKVSPVARKLAE
KLNVDLNKINKDGRIMKEDVLKFAKADEVQIQKLSEIDTSQVGEPINGEKIIKMSPMRKV
IAKRMSESVRTSPTVTYNMSVDTSELKRFKNHIKDICKVTYTDLLIKIVSVVLKQFPLVN
CSISGDSFILKNYVNMGVAVALDEGLIVPVVKDSDKKGLKELSVEFKELAKKAKENKLGP
DDMGGATFTITNLGMYGIDTFSPIINQPEVAILGVNRICETPVVEDGKVIIKPLMNLSLT
ADHRAIDGAYAAQFLAKIKEYIEKPELLLL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagttccttaatagtaatgccgaaacttggattaactatggaagaaggtgaaatagaa
acttggcataaaggtgaaggagaggaagtaaaaaaaggagagattctctttgacgttaca
acagacaagttaactaatgaagttgaagcaaaggaaagtggagtactccgaaaaatattt
gcacaggagggagatacggttaagtgtcttgatcctgtagctataattgccggtaagaat
gaggatatttcaggacttctccaggaagtgaatatagatggtgatgaaatacaaccaaaa
gagactgtatcaccggtatcggataaaaatgagatgcacgaagctgagagcgtacctgtt
aaaagagagggaaggataaaaatatcaccaatagcaaaaaaaattgcccttcagaacaat
gtggattttgaacttataacaggtacaggccccatgggcaggatagtaaagaatgatgta
gagcaatatatcgaaagcaataggattaaagtttcaccggtagcaagaaaattggcagaa
aaacttaatgttgacttgaacaagataaataaagatggaagaatcatgaaggaagatgta
ttgaaatttgcaaaggcagatgaagtacagattcaaaaattatcagaaattgatacaagt
caagtaggtgagccaataaatggtgaaaaaataataaagatgtcacctatgagaaaagtt
attgccaagagaatgagtgaaagtgtacgtacttcacctactgtaacctataatatgagt
gttgatacttcagaattaaagagatttaaaaatcacattaaagatatatgcaaagtaact
tataccgatttgcttataaagatagtatctgtggttttgaaacagtttccacttgtaaat
tgttctatttcaggagattcatttatattaaagaactatgtaaatatgggtgttgcagtt
gcactggatgaaggccttatagtaccagttgtaaaagattcggataaaaaagggttgaaa
gaactttcagtagagttcaaggaacttgcaaaaaaagccaaagaaaacaagcttggtcca
gatgatatgggaggtgctacgtttactataacaaaccttggaatgtatggtatagatacc
ttctctcctattataaatcagccggaagtagctatacttggagttaacaggatatgtgag
actcctgtggtagaagatgggaaagtaattataaaacctcttatgaatctatcccttaca
gcggatcatagagctatagacggtgcttatgcagcacaattcctggcaaaaattaaagaa
tatatagaaaaacctgagttattattactgtaa

DBGET integrated database retrieval system