KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_7671Help
Entry
CTB_7671          CDS       T01327                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
ctz00471  D-Glutamine and D-glutamate metabolism
ctz00550  Peptidoglycan biosynthesis
ctz01100  Metabolic pathways
ctz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CTB_7671 (murC)
   00473 D-Alanine metabolism
    CTB_7671 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTB_7671 (murC)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CTB_7671 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctz01011]
    CTB_7671 (murC)
Enzymes [BR:ctz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CTB_7671 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CTB_7671 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:ctz01011]
 Precursor biosynthesis
  Amino acid ligase
   CTB_7671 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CAX10328
LinkDB All DBs
Position
897511..899922
Genome map
AA seq 803 aa AA seqDB search
MMKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFLGNQEEH
IPEGAVVVYSSSISKKNPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHGKTTVSS
LITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSVITNIDD
EHLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDLHILSYY
QEGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAFRGFSGV
QRRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVGQRRILAIYQPHRFSRLRECIDS
FPSAFKDADEVLLTEVYSAGEEAEDISYQKLAEAISQESIVKCTHIPFHELQRHLEQSIR
VHDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKHLSKSFY
DVSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGEDGAMQG
FLETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDKWLAHIV
EAFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKEIEVSVL
GDGSGAFVVAGLHERRGSGGFIDYQEKYGLSGKSSAQIVFDTDLSKEIQEQILEAADKIY
RLLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLVIDG
LQRFNQRQRLISTSFVDQAFAIQ
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagcttgttttaccactttattggtattggtgggattggaatgagtgcttta
gcacatgttctgctcgatcgaggatatagcgtatcgggaagtgatctttccgaggggaaa
gtggtagagaagctgaagaataaaggagcggaattctttttagggaatcaagaagaacat
atccctgaaggcgctgtagttgtatacagttcaagtatttctaaaaaaaatcctgaattt
ttatcagctaaaagtagagggaaccgcgtagttcatcgagccgaattattagccgagctt
gctcaagatcagatttctatttttgttacaggaagtcatggaaagacaacagtctcttct
ttaattacagccattttgcaggaagcgaagaaaaatccgtcctttgctataggaggtttg
aatcaagaaggcatcaatggtggttcgggatcggaatattttgttgctgaagcagatgag
agcgatgggtctattcggtgttatactccagagttttctgttattacgaatatagatgat
gagcatctgtctaattttgaaggagatcgagagcttcttctggcttctttgaaagacttt
gcactcaagactcagcagatctgttggtataatggagattgtcctcgcttgcgttcatgc
ttgcaagggcatacttttggattggactcttcttgtgatctacatattctatcttattat
caagaaggatggagactgtactttacagcaaagtatcaagatgtagtgtatgcagatata
gaagtgcaattggtcggcatgcataacgttttgaatgctgcagcagctatgggaatagct
ctgtcattgggtatagatgaaggtgctataagaaatgctttcagagggttttcaggagtt
caaagacgattacaaagaaagaattcttctgagacctttctctttttagaagattatgca
caccatccttcagaaatttcttgtacattacgtgctgttcgtactgctgttggacagaga
cgtattttagctatttaccagcctcatcgtttttctcgattaagagagtgtatagacagc
ttcccgtcagcatttaaagatgctgatgaagtcttgttaacagaagtgtacagtgcagga
gaggaggcggaagatatttcgtatcagaagcttgctgaagctattagtcaagagtcgata
gtaaagtgtacgcatattccgtttcatgagttgcagagacatttagagcagtccatccgt
gtacacgatgtgtgtgtatctttaggtgctggtaatattgtgaatttgggagaaaagtta
agagattttgagcctcaaaaactgcacttaggaattatttgtggagggaaatcatgcgaa
cacgagatttccgttctatctgcaaaaaatatagctaaacatctttcaaaatccttttat
gatgtgagttattttttaattactcgagaaggattatgggagagcgtctcttcattagag
actgctgaagactcagggaaatccgtttttgatccagaaatagctcagagactagaaaaa
gtagacgtagtgttgccgatactacatggtccctatggtgaagatggagctatgcaagga
tttctagagactattggcaagccttatacaggtcctgctatcgctttttctgcgatagca
atgaataaagtgtttactaagcgttttatgagtgatttagggattcctgtcgttccttat
ctccctttaacattagcaggatggaagcaagaacaagataagtggttagcacatattgta
gaggctttttcatttcctatgtttgtgaaatcttcgcatttaggatctagtatcggcgtc
ttcgaagttcataatgttatagaattacgagatgccattaatgaagcttttatgcgagat
aacgacgtgtttgtagaagaaaatcgcttaggttgcaaagaaatagaagtttctgtctta
ggagatggatctggtgcgtttgtcgttgctggtctgcatgagcgtcgtgggagtggaggt
tttatagactatcaagagaagtatgggttaagtggtaagtctagtgcgcagatcgtattt
gatacagatctctctaaagaaatacaggaacaaatactagaagctgcggataaaatttac
cgtttattgctagggaaagggtcgtgtcgtattgacttttttgtagatgaagaaggaaat
ttctggttatctgagatgaaccccattcctggaatgacagaaacgagcccatttcttaca
tctttcatccgtaaagggtggagttatgaacagatagtccatcaacttgttattgatggg
ctgcaacgatttaaccaacgccaacgcttgatatcgacgtcttttgtagatcaagcgttc
gctattcagtaa

DBGET integrated database retrieval system