KEGG   Corynebacterium urealyticum DSM 7111: CU7111_0180Help
Entry
CU7111_0180       CDS       T02457                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cua  Corynebacterium urealyticum DSM 7111
Brite
KEGG Orthology (KO) [BR:cua00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CU7111_0180 (ahpF)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CU7111_0180 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA Thi4 HI0933_like Glutaredoxin FAD_binding_3 Thioredoxin_4 FAD_oxidored K_oxygenase DAO NAD_binding_8 Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AGE35778
LinkDB All DBs
Position
complement(220314..221882)
Genome map
AA seq 522 aa AA seqDB search
MAKKLLDDNLKAQLSQLVDRITEKVELVYSLDDRSQSADLKQLLEDIAALSDNITARQDD
ELHERKPSFTIQRAGSDVGVSFAGIPMGHEFSSLVLALLQVGGNPIKEEQDLIDQVAALD
GDFEFTTYMSLTCQNCPTVVQALNAMSVINPRIKHTAVEGSLFQDEVNEKGIQAVPTVYL
NGEEFASGRMDIQDFVARLDDGHAEREAAKLNEKEPYDVLVVGQGPAGATSAIYVARKGL
RVGLVGERFGGQVLDTQSIENYSSIPKTDGQSFAANLEAHVNDYEIDVIKAQSATGLTPG
KDGELSTVHFGENASLKAREVIVATGANWRLMGVPGEDEYRNKGVSFCPHCDGPLFKGKD
IAVIGGGNSGIEAAIDLAGVVNHLTVLEFADTCRADDVLMDTLRSLKNVDIVTSAATKEI
IGNGKEVTGLKYEDRTTGEEKTLELSGLFIQIGLLPNTKWLEGSGVELNQMGEIVIDAKG
KTNVPGVYGAGDCATVPFKQIVIATGTGATAGLSAWEHNAIG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagctcctagatgacaacctgaaggcccagctcagccagctggtcgaccgc
atcaccgagaaggtcgagctcgtttactccctcgacgaccgcagccagtccgcagacctc
aagcagctgctcgaggacatcgcggcactctccgataacatcaccgcccgccaggacgac
gagctgcacgagcgcaagccttccttcaccattcagcgtgcaggcagcgacgtcggcgtc
agcttcgcgggcatcccgatgggtcacgagttcagctccctggtgctggcactcctccag
gtcggcggtaacccgatcaaggaagagcaggacctcatcgaccaggtcgcagccctggac
ggggacttcgagttcacgacctacatgtccctgacctgccagaactgcccgaccgtggtg
caggcactgaacgcgatgtccgtcatcaacccgcggatcaagcacaccgcggtggaaggc
tccctcttccaggacgaggtcaacgagaagggcatccaggccgtcccgaccgtctacctc
aacggcgaggagttcgcctccggccgcatggacatccaggacttcgtcgcccgcctcgac
gacggccacgcggagcgcgaggctgcgaagctcaatgagaaggagccctacgacgtcctc
gtcgtcggtcagggcccggcaggcgcgacctccgcgatctacgtcgcccgtaagggcctg
cgcgtcggcctcgtcggtgagcgcttcggtggccaggtgctggatacccagtccatcgag
aactacagctccatcccgaagaccgatggccagtccttcgcggcgaacctcgaggcgcac
gtcaacgactacgagatcgacgtcatcaaggcgcagtccgcaaccggcctgaccccgggc
aaggacggcgaactcagcaccgtccacttcggagagaacgcctccctcaaggcccgcgag
gtcatcgtcgccaccggcgcgaactggcgactcatgggtgtgccgggcgaggacgagtac
cgcaacaagggtgtctccttctgcccgcactgtgatggcccgctgttcaagggcaaggac
atcgccgtcattggtggcggtaactccggcatcgaggccgccatcgacctcgccggcgtg
gtcaaccacctcaccgtcctggagttcgcagacacctgccgcgctgacgacgtcctcatg
gacaccctgcgcagcctgaagaacgtcgacatcgtcacctccgcggcgacgaaggagatc
atcggcaatggcaaggaggtcaccggcctgaagtacgaggaccgcaccaccggtgaggag
aagaccctcgaactttccggcctgttcatccagatcggcctgctaccgaacaccaagtgg
ctggagggctccggcgtggagctgaaccagatgggcgagatcgtcatcgacgccaagggc
aagaccaacgtgccgggtgtctacggcgctggcgactgcgccaccgtgccgttcaagcag
atcgtgatcgccacgggtaccggtgcgaccgccggcctttccgcctgggagcacaacgcg
atcggctaa

DBGET integrated database retrieval system