KEGG   Corynebacterium urealyticum DSM 7111: CU7111_0207Help
Entry
CU7111_0207       CDS       T02457                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua00020  Citrate cycle (TCA cycle)
cua00190  Oxidative phosphorylation
cua00650  Butanoate metabolism
cua01100  Metabolic pathways
cua01110  Biosynthesis of secondary metabolites
cua01120  Microbial metabolism in diverse environments
cua01130  Biosynthesis of antibiotics
cua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CU7111_0207 (sdhA)
   00650 Butanoate metabolism
    CU7111_0207 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CU7111_0207 (sdhA)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CU7111_0207 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CU7111_0207 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO GIDA NAD_binding_8 Pyr_redox_2 Pyr_redox FAD_binding_3 AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGE35803
LinkDB All DBs
Position
260203..262236
Genome map
AA seq 677 aa AA seqDB search
MSDVINHPHNQTADFNYDEAVAAFTAPESSVDGVTVGKVLKDNAPHEVGQDQQWTYAKDH
FGLVSPLNRNKFRVLIVGTGLAGGAAAAALGELGYDVKVFTYHDSPRRAHSIAAQGGVNS
SRGKKLDNDSTYLHTKDTVKGGDYRCRENDCWRLAMESPKVIDHMNAIGAPFSREYGGTL
ATRSFGGVQVSRTYYTRGQTGQQLQLATTSALYRQIGAGNVEIFTHADMQDVIVENGVCK
GVVMRNLITGELTAHTGHATVLATGGYGNVYHMSTLAKNSNVSAIMRAYDQGAYMASPSF
VQFHPTGLPVNSDWQSKTILMSESLRNDGRIWTPKKKGDDRDPNNIPDDERDYFLERRYP
AFGNLVPRDIASRANAQQINAGYGVGPKKNSVYLDLGDAIKRLGKDTIRERYGNLIQMYE
EAIGESAYETPMRIAPTCHYTMGGLWTDFHEMTSIPGLFCAGEASWMYHGANRLGANSLL
SSSVEGWFTLPFTIPNYLAPLLGEEVSAEDSPAAQEALERSQKRIERIMNVRGEEPHGAA
YYHRQLGEILYFSCGVSRNVEDMKDGIEKIRALRKEFWANVHVPGEANEMNQELEYALRV
ADYLDLGELMCVDALDRDESCGAHYRDDHLSEDGEAERDDDNWCFVSAWESNGDEKFIRH
SEPLYFDRIPLMTRNYK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttattaaccacccgcacaaccaaactgcggatttcaactacgacgaggca
gtcgcagctttcaccgcgcctgagtcctccgtcgacggcgtgaccgtcggcaaggtcctg
aaggacaacgccccgcacgaggtaggccaggatcagcagtggacctacgccaaggaccac
ttcggcctggtatccccgctgaaccgcaacaagttccgcgtcctgatcgtcggtaccggc
ctagccggtggcgctgccgccgcagccctcggcgagctgggctacgacgtgaaggtcttc
acgtaccacgattccccacgccgcgcgcactccattgctgcgcagggtggtgtgaactcc
tcccgcggtaagaagctggataacgactcgacctacctccacaccaaggacacggtcaag
ggcggcgactaccgctgccgcgagaacgactgctggcgcctggcgatggagtccccgaag
gtcatcgaccacatgaacgccatcggcgcaccgttctcccgcgagtacggcggcaccctg
gcaacccgttccttcggtggggtgcaggtctcccgcacctactacacccgtggtcaaacg
ggtcagcagctgcagctggcgacgacctccgcgctgtaccgccagatcggcgccggcaac
gtggagatcttcacccacgcagacatgcaggacgtcatcgtcgagaacggcgtctgtaag
ggcgtcgtgatgcgcaacctgatcaccggtgagctgaccgctcacaccggccacgcaacc
gtgctggccaccggtggttacggcaacgtgtaccacatgtctaccctggcgaagaactcc
aacgtctccgccatcatgcgcgcctacgaccagggtgcctacatggcatccccgtccttc
gtgcagttccacccgaccggcctgccggtcaactcggactggcagtccaagaccatcctg
atgtccgagtccctgcgtaacgacggccgcatctggaccccgaagaagaagggcgacgat
cgcgacccgaacaacatcccggacgacgagcgcgactacttcctggagcgtcgttacccg
gcattcggcaacctggtcccgcgtgacatcgcgtcccgcgcgaacgcccagcagatcaac
gccggctacggcgttggcccgaagaagaactccgtctacctggacctgggtgacgccatc
aagcgcctcggcaaggacaccatccgcgagcgctacggcaacctgattcagatgtacgag
gaggccatcggtgagtccgcgtacgagaccccgatgcgcatcgcaccgacctgccactac
accatgggtggcctgtggaccgacttccacgagatgacctccattccggggctcttctgt
gccggtgaggcatcctggatgtaccacggtgcaaaccgactgggtgctaactccctgctc
tcctcctccgtcgagggctggttcaccctgccgttcacgatcccgaactacctggcgccg
ctgctgggcgaggaggtctctgctgaggactccccggccgcacaggaggccctggagcgc
tctcagaagcgcatcgagcggatcatgaacgtccgtggcgaggagccacacggcgcggcg
tactaccaccgtcagctcggcgagatcctgtacttctcctgtggcgtgtcccgcaacgtc
gaggacatgaaggacggcatcgagaagatccgcgcactgcgtaaggaattctgggccaac
gtccacgtcccgggcgaagccaacgagatgaaccaggagctggagtacgcactgcgcgtg
gccgactacctggacctcggcgagctcatgtgcgtcgacgcactggaccgcgacgagtct
tgcggtgcccactaccgcgatgaccacctctccgaggacggcgaggccgagcgtgacgat
gacaactggtgcttcgtttccgcttgggagtcgaacggcgatgagaagttcatccgccac
tccgagccgctgtacttcgatcgaatcccgctgatgacaaggaattacaagtaa

DBGET integrated database retrieval system