KEGG   Corynebacterium urealyticum DSM 7111: CU7111_0208Help
Entry
CU7111_0208       CDS       T02457                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua00020  Citrate cycle (TCA cycle)
cua00190  Oxidative phosphorylation
cua00650  Butanoate metabolism
cua01100  Metabolic pathways
cua01110  Biosynthesis of secondary metabolites
cua01120  Microbial metabolism in diverse environments
cua01130  Biosynthesis of antibiotics
cua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CU7111_0208 (sdhB)
   00650 Butanoate metabolism
    CU7111_0208 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CU7111_0208 (sdhB)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CU7111_0208 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CU7111_0208 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4 Fer4_9 Fer4_16 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_15 Fer4_3 Fer2 Fer4_22 Fer4_21 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AGE35804
LinkDB All DBs
Position
262236..262985
Genome map
AA seq 249 aa AA seqDB search
MKLNLEIWRQAGPNAEGHFESVKVDDAAEQMSILELLDHVNTMYVEAGKEPFAFASDCRE
GICGTCGLMVNDRPHGPDQNKPACQQRLVSFNDGDTIKLEPLRSAAYPVIKDMVVDRSAL
DRVMEKGGFVSVQAGTAPDADDLLVNHSDAEKALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLTLSPMGREERGKRARAMVDEVETNFGHCSLYGECADVCPAGIPLTAVAAITKERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaatcttgaaatttggcgtcaggcgggcccgaacgccgaaggccacttcgag
tccgtcaaggttgacgacgccgcagagcagatgtccatcctggagctgctggaccacgtc
aacaccatgtacgtcgaggctggcaaggagcccttcgccttcgcctctgactgccgcgag
ggtatctgtggtacctgtggcctgatggtgaacgaccgtccgcacggcccagaccagaac
aagcctgcttgccagcagcgcctggtttccttcaacgatggcgacaccatcaagctggag
ccgctgcgctccgctgcatacccggtcatcaaggacatggtcgtcgaccgttccgcgctg
gaccgcgtcatggagaagggcggcttcgtttccgtccaggctggtaccgcaccggacgcc
gacgacctgctggtcaaccactctgacgcggagaaggctctggaccacgcggcctgcatc
ggctgtggtgcgtgtgtcgcagcctgcccgaacggcgctgctcacctgttcaccggcgcg
aagctggttcacctcaccctgtccccgatgggtcgcgaggagcgcggcaagcgcgcccgc
gccatggtcgacgaggtggagaccaacttcggtcactgctccctgtacggcgagtgcgcg
gacgtctgcccggctggcatcccgctgaccgccgttgccgcgatcacgaaggagcgcgca
cgtgctgccttccgcggtaaggacgactag

DBGET integrated database retrieval system