KEGG   Corynebacterium urealyticum DSM 7111: CU7111_0303Help
Entry
CU7111_0303       CDS       T02457                                 

Gene name
tuf
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
cua  Corynebacterium urealyticum DSM 7111
Brite
KEGG Orthology (KO) [BR:cua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cua03012]
    CU7111_0303 (tuf)
   03029 Mitochondrial biogenesis [BR:cua03029]
    CU7111_0303 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cua04147]
    CU7111_0303 (tuf)
Translation factors [BR:cua03012]
 Eukaryotic Type
  Elongation factors
   CU7111_0303 (tuf)
 Prokaryotic Type
   CU7111_0303 (tuf)
Mitochondrial biogenesis [BR:cua03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CU7111_0303 (tuf)
Exosome [BR:cua04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CU7111_0303 (tuf)
  Exosomal proteins of breast cancer cells
   CU7111_0303 (tuf)
  Exosomal proteins of colorectal cancer cells
   CU7111_0303 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGE35899
LinkDB All DBs
Position
378664..379854
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLHETYPEQNKAFAYDAIDKAPEEKE
RGITINISHVEYETEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEELLELVEMEVRELLAEQDYDEEAPVVPISALGAL
EGEQKWVDSVLELMKACDESIPDPERETDKPFLMPVEDIFTITGRGTVVTGRVERGVLNL
NDEVEILGIREKSTKTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQIIAKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVTLPEGTDMVMPGDNVE
MSVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKINK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcaaagttcgagcgcacaaagccgcacgtaaacatcggtaccatcggtcac
gttgaccacggtaagaccaccacgactgctgcgatcaccaaggttctgcacgagacctac
ccagagcagaacaaggccttcgcctacgacgccatcgataaggcgccggaggagaaggag
cgcggcatcacgattaacatttctcacgtcgagtacgagactgagaagcgtcactacgca
cacgttgatgccccggggcacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgccatcctggttgttgctgcaaccgatggcccgatgccgcagacccgcgag
cacgttctgctggctcgccaggttggcgttccgtacatcctcgttgcactgaacaagtgc
gacatggttgacgatgaggagctcctcgagctcgtcgagatggaggtccgcgagcttctg
gctgagcaggactacgacgaggaggctccggtcgtcccgatctccgcactgggcgccctg
gagggcgagcagaagtgggtcgactccgtcctcgagctgatgaaggcttgcgacgagtcc
atcccggacccggagcgcgagaccgacaagccgttcctgatgccggttgaggacatcttc
accattaccggtcgcggcaccgtcgttaccggccgtgttgagcgtggcgtcctgaacctg
aacgacgaggtcgagatcctgggcatccgcgagaagtccaccaagaccaccgtcacctcc
atcgagatgttcaacaagctgctggacaccgcagaggctggcgacaacgctgccctgctg
ctgcgtggtctgaagcgtgaggacgtcgagcgcggccagatcatcgctaagccgggcgct
tacaccccgcacaccgagttcgagggctccgtctacgtcctgtccaaggacgagggcggc
cgtcacaccccgttcttcgacaactaccgtccgcagttctacttccgtaccaccgacgtc
accggtgtcgttaccctgccagagggcaccgacatggtcatgccgggcgacaacgttgag
atgagcgtcaagctgatccagccggtcgcaatggacgagggcctgcgcttcgctatccgt
gagggtggccgcaccgttggtgctggtcgtgtgaccaagatcaacaagtaa

DBGET integrated database retrieval system