KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1205Help
Entry
CU7111_1205       CDS       T02457                                 

Definition
(GenBank) serine/threonine protein kinase PknL
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cua  Corynebacterium urealyticum DSM 7111
Brite
KEGG Orthology (KO) [BR:cua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cua01001]
    CU7111_1205
Enzymes [BR:cua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CU7111_1205
Protein kinases [BR:cua01001]
 Serine/threonine kinases: Other
  Bacterial family
   CU7111_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AGE36796
LinkDB All DBs
Position
1424727..1427078
Genome map
AA seq 783 aa AA seqDB search
MEPQPGSYLDDRYHLGAKIAKGGMSTVYHAVDTRLDREVAVKIMNPELATDPTFRTRFER
EARAVAKLTHPDLVNVFDQGEDGPFVFLVMELVDGGSLRELLRERGPMPPHAALSVMEPV
LTALSVAHTTGMIHRDIKPDNVLISANHQVKLADFGLVRAVSTGSGEAARTSATGQVIGT
VAYLSPEQVQGHSLGATSDVYSAGVLLYELLTGETPFNGGSPVETALNRLTQDVPAPSEI
IDGVPPEIDDLVLRACQRAPEDRFADGSEFLAAVRQTAAELQLPAFRVPVPADSAVQHAL
AGSSFTDRLAWDDEAMSTRAVTLDPAAGTHEDGHTAETRYSAPGQAHETSETALVDPYGD
YSPAEADQGYNQWAQPAQPQEYGAAPGYAEPQHYPAAPAGYPPQQSSGYPAPEHRPTPPP
APTKKLSNRSTVKGLLWTVIITALVIAIALGGWWLTSGRYGQIPSVVGLDREAAIVKVED
AGFVSQVDEQFSDDHPAKKVMGTDPPFGERAPKGSQVSVLVSLGAPTVPIPGETDTAETY
SAKLTSRTLVAEIGEEVYSDDAKKGTVAEVSPSPGSEVRTGSTVTIHVSRGPKPVRVPGV
AGQKLDRAKKTLESAGLKVGKTIKEFDPDADPGTVLRTTPSKGTEVPSKSEVTIVVNNAT
EVPDITGLSKSEAIAELRDAGLDPVDDGEVYDEDVSGGDVASQSPEAGTVVDPSRDTQVK
FRVSNAESVPFVLGMRAEKAREKLEDAGFEVEISGSEDGLVWSQSPNTGRKAQKGDTVRI
STF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcaacccggcagctacctcgacgaccgctaccacctgggcgcaaagatcgcc
aagggcggaatgtcgacggtctaccatgccgtggacactcgcctggaccgtgaggttgcg
gtgaaaatcatgaacccggagcttgcgaccgatccgaccttccgcacccgcttcgagcgg
gaagcccgggcagtcgccaagctcacgcacccggatctggttaacgtcttcgaccagggc
gaggacggcccgttcgtcttcctcgtcatggaactcgtggacggcggttcgctgcgggag
ctgctccgggagcgcggcccaatgccgccgcacgccgcgctctcagtgatggagccggtg
ctcaccgcgctatcggttgcccacacgacgggcatgatccaccgggacatcaagccggat
aacgtgctgatcagcgctaatcaccaggtcaagctcgcggacttcggtctcgtccgcgcg
gtctcgacgggctcgggtgaagcggcgcgcacctccgccaccgggcaggtcatcggcacc
gtcgcctacctttctcccgagcaggtccagggccattccctgggcgcgacctccgatgtc
tattccgccggggtgctgctctacgagctgctgaccggcgagaccccgttcaacggtggc
agccccgtcgagactgcactgaaccggctgacacaggacgtccccgccccctccgagatc
atcgacggggtgccacccgagatcgacgacctcgtgctgcgggcctgccagcgggcaccg
gaggatcgattcgcggacggttccgagttcctcgccgcggtccgccagaccgctgcggaa
ctccaacttccggctttccgggtgcccgtcccggccgattccgcggtgcagcacgccctg
gcaggctcgagcttcaccgaccgcctggcctgggacgacgaggcgatgtccacccgagcg
gtcactctcgaccccgcggcgggcacccacgaggacgggcacacggccgagacccgctac
tcggctccgggccaggctcacgagacgtcggagaccgcgctggtcgacccctacggggat
tactcccccgccgaggctgatcagggctataaccagtgggcccagccagcccagccccag
gagtatggggctgcgccgggctacgcggagccacagcactaccccgctgctcccgccggc
tacccgccgcagcaatccagcggctacccggcacccgaacatcgccccacgcctccaccg
gcgccaacgaaaaaactcagcaaccgctccactgtcaagggtctgctgtggaccgtgatc
atcaccgcgctggtgatcgcgatcgcgctcggcggctggtggctgacctctggccgctat
ggccagatcccctcggtcgtcggcctcgaccgggaggcggcgatcgtcaaggtggaggac
gcaggcttcgtctcccaggtggatgagcaattctccgacgaccacccggcgaagaaagtg
atggggaccgatcccccttttggtgaacgggcaccgaagggaagccaggtttcggtgctc
gtcagcctcggggcgccgaccgtcccgatccctggtgagacggacacggcggagacctat
tccgccaagctgacgtcccgcaccctcgtcgccgagatcggcgaggaggtctactccgac
gacgcaaagaagggcaccgtcgccgaggtgtccccctctcccggcagcgaggtccgcacc
gggtccacggtgacgatccacgtctcccgcgggccaaagccggtccgggttccaggtgtg
gcgggtcagaagctggaccgggcgaagaagaccctggaatccgccggcctgaaggtgggc
aagacgatcaaggagttcgaccccgacgccgacccgggcaccgtcctgcgcaccacgccc
tcgaagggcacggaggtgccgagcaagtccgaggtcaccatcgtggtcaacaatgccacg
gaggtcccggacatcacggggctgagcaagtctgaggccatcgccgagctgcgcgatgcg
ggtctggacccggtcgatgacggcgaggtttatgacgaggacgtctccggcggcgacgtc
gcctcccagtcgccggaggcgggcacggtcgtcgacccgtcccgggacacgcaggtgaag
ttcagggtctccaacgccgagtcggtccccttcgtgttggggatgcgggcggagaaggcc
cgagagaagctggaagacgcgggcttcgaggtcgagatttcgggctcggaggacggcctg
gtgtggagccagtcgccgaacaccggtcggaaggcacagaagggcgacacggtgcggatt
tcgaccttctag

DBGET integrated database retrieval system