KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1762Help
Entry
CU7111_1762       CDS       T02457                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua00010  Glycolysis / Gluconeogenesis
cua00071  Fatty acid degradation
cua00350  Tyrosine metabolism
cua00625  Chloroalkane and chloroalkene degradation
cua00626  Naphthalene degradation
cua01100  Metabolic pathways
cua01110  Biosynthesis of secondary metabolites
cua01120  Microbial metabolism in diverse environments
cua01130  Biosynthesis of antibiotics
cua01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CU7111_1762 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CU7111_1762 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CU7111_1762 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CU7111_1762 (adhA)
   00626 Naphthalene degradation
    CU7111_1762 (adhA)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CU7111_1762 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 adh_short TrkA_N Methyltransf_11 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AGE37346
LinkDB All DBs
Position
2080396..2081424
Genome map
AA seq 342 aa AA seqDB search
MTDTTFRAAVVEDFGPELNLRDVEMPTPGRNQALVKLQASGICHTDLHAAEGDWPVKPEP
PFVPGHEGVGEVVELGPGDHSVKVGDIVGNVWLWSACGECEYCRTGWETLCNQAEYGGYT
VNGSFGTYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKVSETKPGQFMVISGVGG
LGHIAVQYAVAMGMRVIAVDIADEKLELAKKHGAEFTVNAKHADPAEAVQEFTDGGAHGV
LVTAVHPQAFGQAVGMARKGGTIVFNGLPPGDFPAPIFEIVFKALTIRGSLVGTRQDLAE
ALDFYARGLIKPTVSECSLDDVNAVFEELRHGKVDGRMSIRY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaacgttccgcgccgccgtcgttgaggacttcggtcccgaactcaacctc
cgcgacgtcgagatgcccacgcccggccgcaaccaggcgctggtgaagctgcaggcctcc
ggcatctgccacaccgacctccatgccgccgagggtgactggcccgtcaagcccgagccg
cccttcgttcccggccacgagggtgtcggcgaggtcgtcgaactcggccccggtgaccac
tccgtcaaggtcggcgacatcgtcggcaacgtctggctctggtccgcctgcggtgagtgc
gagtactgccgcaccggatgggagaccctgtgcaaccaggccgagtacggcggctacacc
gtcaacggctccttcggcacctacatgctcgtggatacccgctactgcgcccgcatcccc
gagggctccgaccccgtcgaggtcgccccgatcctgtgcgccggcgtcaccgtctacaag
gggctgaaggtctccgagaccaagcccggtcagttcatggtcatctccggcgtcggcggc
ctcggccacatcgccgtccagtacgccgtggccatgggtatgcgcgtcatcgccgtcgac
atcgccgacgagaagctcgagctggccaagaagcacggcgcggagttcaccgtcaacgcc
aagcacgccgacccggccgaggcggtccaggagttcaccgacggcggcgcccacggtgtc
ctggtcaccgcggtccacccgcaggcgttcggccaggcggtcggcatggcccgcaagggc
ggcaccatcgtgttcaacggcctgcccccgggggacttcccggccccgatcttcgagatc
gtgttcaaggccctgaccatccgcggctccctcgtgggtacccgccaggacctggccgag
gcgctcgacttctacgcccgcggcctgatcaagccgaccgtgtccgagtgctccctcgac
gacgtcaacgccgtcttcgaggaactgcgccacggcaaggtcgacggccgcatgtccatc
cgctactag

DBGET integrated database retrieval system