KEGG   Curtobacterium sp. BH-2-1-1: BJK06_07965Help
Entry
BJK06_07965       CDS       T04562                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00250  Alanine, aspartate and glutamate metabolism
cub00280  Valine, leucine and isoleucine degradation
cub00310  Lysine degradation
cub00410  beta-Alanine metabolism
cub00640  Propanoate metabolism
cub00650  Butanoate metabolism
cub01100  Metabolic pathways
cub01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJK06_07965
   00650 Butanoate metabolism
    BJK06_07965
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJK06_07965
   00280 Valine, leucine and isoleucine degradation
    BJK06_07965
   00310 Lysine degradation
    BJK06_07965
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJK06_07965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cub01007]
    BJK06_07965
Enzymes [BR:cub01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BJK06_07965
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BJK06_07965
    2.6.1.48  5-aminovalerate transaminase
     BJK06_07965
Amino acid related enzymes [BR:cub01007]
 Aminotransferase (transaminase)
  Class III
   BJK06_07965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Inositol_P
Motif
Other DBs
NCBI-ProteinID: AOX65696
LinkDB All DBs
Position
complement(1689953..1691317)
Genome map
AA seq 454 aa AA seqDB search
MSSTVAPSTSAAAGGPSLPQERRLVTEVPGPRSRALFERKAAAVASGVGVAVPIAVVAAG
GGVVVDADGNSFVDLGSGIAVTSVGNAHPGVVDAVQQQVQAFTHTCFTIAAYDGYVEVAE
ALNRLTPGDHEKRSALFNSGAEAVENAVKIARKHTGRQAIVVFDHAYHGRTNLTMALTAK
NQPYKNGFGPFAPEVYRVPMSYPFRDGGLSGAEAAKRAISQIEKQVGAENTAAVLVEPIQ
GEGGFVVPAPGFLAALSEWTTANDVVFIADEVQTGFARTGAMFASEHEGIVPDIVTTAKG
MAGGMPLSAVTGRAEIMDSAHVGGLGGTYGGNPVACAAALAAIHAFEHDGLVERAAEIGD
VLLGRLRAAQATDPRIGDVRGRGAMIAIELVDPATGEPDAALTGRVVRYAYEHGVIALTA
GTYGNVLRFLPPLAIDDDLLHEGLDIVLEGLAAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccgtcgcaccctcgaccagcgccgccgcgggcggcccctcgctgccccag
gaacggcggctcgtcacggaggtgccgggcccccgctcccgagcgctcttcgaacgcaag
gccgccgccgtggcgtccggcgtcggggtcgcggtaccgatcgccgtcgtcgcggccggt
ggcggcgtggtcgtcgacgcggacggcaactcgttcgtcgacctcggctccgggatcgcc
gtgacgagcgtcggcaacgcgcacccgggcgtggtcgacgccgtgcagcagcaggtccag
gcgttcacgcacacctgcttcaccatcgccgcctacgacgggtacgtcgaggtcgccgag
gcgctcaaccggctcacccccggcgaccacgagaagcggagcgcgctcttcaactccggc
gccgaggcggtcgagaacgcggtgaagatcgcccgcaagcacaccggtcggcaggcgatc
gtggtgttcgaccacgcctaccacgggcggacgaacctcacgatggcgctcaccgcgaag
aaccagccgtacaagaacggcttcggtcccttcgcgcccgaggtctaccgcgtcccgatg
tcgtacccgttccgcgacggcggactgtccggtgccgaggcggcgaagcgcgcgatcagc
cagatcgagaagcaggtcggcgcggagaacactgccgcggtgctcgtcgagccgatccag
ggcgagggcggcttcgtcgtcccggcacccgggttcctcgccgcgctgtcggagtggacc
accgcgaacgacgtcgtgttcatcgccgacgaggtgcagaccgggttcgcccgcaccggc
gccatgttcgcgagcgagcacgagggcatcgtccccgacatcgtcaccaccgccaagggc
atggccggcgggatgccgctctccgccgtcaccgggcgcgccgagatcatggactccgcc
cacgtcggcggactcggcggcacgtacggcggcaaccccgtcgcgtgcgccgcagcactc
gccgcgatccacgccttcgagcacgacggcctggtcgagcgcgctgccgagatcggcgac
gtgctgctcggacgactccgcgccgcacaggcgaccgacccccgcatcggcgacgtccgc
ggccgcggcgccatgatcgcgatcgaactcgtcgacccggcgaccggggaacccgacgcc
gcgctcaccggacgggtcgtacggtacgcgtacgagcacggcgtgatcgccctcaccgcg
gggacgtacggcaacgtcctccgcttcctccccccgctcgcgatcgacgacgacctgctc
cacgaggggctcgacatcgtcctggaaggactcgcagcagcatga

DBGET integrated database retrieval system