KEGG   Curtobacterium sp. BH-2-1-1: BJK06_08150Help
Entry
BJK06_08150       CDS       T04562                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00473  D-Alanine metabolism
cub00550  Peptidoglycan biosynthesis
cub01100  Metabolic pathways
cub01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJK06_08150
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJK06_08150
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJK06_08150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cub01011]
    BJK06_08150
Enzymes [BR:cub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJK06_08150
Peptidoglycan biosynthesis and degradation proteins [BR:cub01011]
 Precursor biosynthesis
  Amino acid ligase
   BJK06_08150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST TTL ATPgrasp_YheCD ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AOX65725
LinkDB All DBs
Position
complement(1726688..1727650)
Genome map
AA seq 320 aa AA seqDB search
MAELTRRHVVVVAGGISHERDVSLRSGRRVADSLTGYGWQVDLRDADASLLPTLRESRPD
VVWPALHGASGEDGALRGILEALDIPFVGSRSTSARLAWDKPTASALVARAGVRTPRSVT
LSHDVFRELGAVGVLESIAVEHPVPLAVKPARGGSAQGVTLVDDVNDLPRAMVTAYTYCD
DVVVEQLIRGTEVAVGIIDTGDGPVALSAVEIVPRSGIYGFEARYNAGETTFYTPARLSE
EFAAAASSAAVAAHQALGLRHISRVDLIVDAAGTPWFLEANVLPGLTETSLVPQALSASG
FDLGWTYAELAEQAIRDHRA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctcacccgccgtcacgtcgtcgtcgtcgcgggagggatctcgcacgagcgt
gacgtctccctgcggtccggtcgccgtgtggccgactcgctgaccgggtacggctggcag
gtggacctccgcgacgcagacgcttcgttgctgccgaccctgcgggagagccgcccggac
gtcgtgtggccggctctgcacggcgcctctggtgaggacggcgccctgcggggcatcctg
gaggcgctggacatcccgttcgtcggctcacgttcgacgtcggcccggctggcatgggac
aagcccaccgcttcggcgctggtcgcgcgggcgggcgtccggacccctcgctcggtcacg
ctctcgcacgacgtcttccgggagctcggcgcggtcggcgtcctcgagagcatcgcggtc
gagcacccggtcccactcgccgtcaagccggcccgaggcggcagcgcccagggcgtcacc
ctcgtcgacgacgtgaacgacctgccgcgcgcgatggtcaccgcgtacacgtactgcgac
gacgtcgtggtcgagcagctcatccgtgggaccgaggtcgcggtcggcatcatcgacacc
ggcgacggtccggtggcgctctccgccgtcgagatcgtcccacgcagcggcatctacggg
ttcgaggctcggtacaacgccggcgagaccaccttctacacgccggcccgcctgtccgag
gagttcgcggctgctgcgtcctccgccgccgtggcagcccaccaggccctcggtctgcgg
cacatctcgcgcgtcgacctcatcgtcgacgccgctgggacgccctggttcctcgaggcg
aacgtcctccccgggctcaccgagacctctctcgtgccgcaggccctctccgcgtcgggc
ttcgacctgggatggacctacgccgagctcgcggagcaggcgatccgcgaccaccgggcc
tga

DBGET integrated database retrieval system