KEGG   Curtobacterium sp. BH-2-1-1: BJK06_09715Help
Entry
BJK06_09715       CDS       T04562                                 

Definition
(GenBank) hypothetical protein
  KO
K07228  TrkA domain protein
Organism
cub  Curtobacterium sp. BH-2-1-1
Brite
KEGG Orthology (KO) [BR:cub00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BJK06_09715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C
Motif
Other DBs
NCBI-ProteinID: AOX65996
LinkDB All DBs
Position
2039804..2040334
Genome map
AA seq 176 aa AA seqDB search
MVDVHRVKLPGVGVLHSFYTDDGGKCGVITHRSGHSDLISFADVSDGADKSEKVSLRLSE
DEAHTLAELLGGTRITEGLDKLDEIPGLSIDWFSVDYDDAIAGKPLGDLHDSGFIGLTVV
AVVRGDSANPAPSSDFVVFPGDTIVVAGAPEKVAKAFSFYRSGELAAAAAEAPPRS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgtccatcgcgtcaaactccccggagtcggcgtgctgcacagcttctacacc
gacgacggtggcaagtgcggtgtcatcacgcaccggtcgggtcactccgacctcatctcc
ttcgccgacgtctcggacggcgccgacaagtcggagaaggtgtcgctgcgcctcagtgag
gacgaggcgcacacgctcgccgagctcctcggcggcacgcgcatcaccgagggcctcgac
aagctcgacgagatcccgggcctcagcatcgactggttctcggtcgactacgacgacgcc
atcgccggcaagcccctcggcgacctgcacgactcgggcttcatcggcctgaccgtcgtg
gcggtcgtccgtggtgacagcgccaacccggccccgtcgtccgacttcgtcgtgttcccg
ggcgacaccatcgtcgtcgccggtgcacccgagaaggtcgcgaaggcgttctcgttctac
cgcagcggagagcttgcggccgctgcggccgaggccccgccgaggagctag

DBGET integrated database retrieval system