KEGG   Curtobacterium sp. BH-2-1-1: BJK06_16905Help
Entry
BJK06_16905       CDS       T04562                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00010  Glycolysis / Gluconeogenesis
cub00071  Fatty acid degradation
cub00350  Tyrosine metabolism
cub00625  Chloroalkane and chloroalkene degradation
cub00626  Naphthalene degradation
cub01100  Metabolic pathways
cub01110  Biosynthesis of secondary metabolites
cub01120  Microbial metabolism in diverse environments
cub01130  Biosynthesis of antibiotics
cub01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJK06_16905
  Lipid metabolism
   00071 Fatty acid degradation
    BJK06_16905
  Amino acid metabolism
   00350 Tyrosine metabolism
    BJK06_16905
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJK06_16905
   00626 Naphthalene degradation
    BJK06_16905
Enzymes [BR:cub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BJK06_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 2-Hacid_dh_C Methyltransf_31 PCMT Methyltransf_11 DUF1364 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOX67173
LinkDB All DBs
Position
complement(3561041..3562105)
Genome map
AA seq 354 aa AA seqDB search
MQAAVVHAFGQPLIVDERPLPDPGPGQVLVRIEASGLCHTDIHAAHGDWPVRPTPPFVPG
HEGVGIVEAVGPDVTERRVGERVALPWLGHACGACRYCIDGRETLCEQQQNTGYSIDGAF
AQFAVADAEYAVPVPAGVDPWDAAPLTCAGVTTYKALKVAHVVPAETVAVFGVGGLGHLA
VQYARVFGADVIGVDVEPEKLRLARDLGADHTVDASSGDAAAQVQELGGADVAVVLAASA
AVFEQAFASLKRGGRLVCVALPADGTMSVPIFDTVLKGISIIGSIVGTRQDLAEVFALHA
AGRTRVVSVRRPLADVNDAMADVLAGRVPARIVFELPAVEREAVVLGPDERVGR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcagtcgtccacgcattcggacagcccctcatcgtcgacgaacgaccactc
ccggatcccggccccgggcaggtgctcgtccggatcgaggcgtcggggctctgtcacacc
gacatccacgcagcgcacggcgactggcccgtccgcccgaccccgccgttcgtccccgga
cacgagggcgtcggcatagtcgaggcggtcgggcccgacgtcaccgagcggcgcgtcggc
gaacgggtcgcactcccctggctggggcacgcgtgcggcgcctgccgctactgcatcgac
ggccgcgagacgctgtgcgagcagcagcagaacacgggttactcgatcgacggcgccttc
gcccagttcgcggtggcggacgcggagtacgcggtaccggtgcccgccggggtcgacccg
tgggacgcggcaccgctcacctgcgccggcgtgaccacgtacaaggccctcaaggtcgcc
cacgtcgtacccgccgagaccgtggccgtcttcggcgtcggcggcctcggacacctcgct
gtgcagtacgcccgagtcttcggtgccgacgtgatcggggtcgacgtcgagcccgagaag
ctccgactcgcgcgggacctcggtgccgaccacaccgtcgatgcatcgtccggcgacgcc
gcggcgcaggtgcaggagctcggcggcgccgacgtcgccgtcgtcctggccgcgtccgcc
gcggtgttcgagcaggccttcgcgtcgctgaagcgcggcggtcgactcgtctgtgtggcg
ctgccggcggacgggacgatgtccgtcccgatcttcgacaccgtcctcaagggcatctcg
atcatcgggtcgatcgtcggcacgcggcaggacctcgccgaggtgttcgcactgcacgcg
gccggtcgaacccgtgtcgtctccgtccgtcgtccgctggccgacgtgaacgacgcgatg
gcggacgtcctcgcgggacgtgtgccggcgcgcatcgtgttcgagttgcccgccgtcgaa
cgcgaggccgtcgtgctcggaccggacgagcgggtcgggcgatga

DBGET integrated database retrieval system