KEGG   Corynebacterium ulcerans 809: CULC809_00066Help
Entry
CULC809_00066     CDS       T01880                                 

Definition
(GenBank) hypothetical protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00500  Starch and sucrose metabolism
cuc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CULC809_00066
Enzymes [BR:cuc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CULC809_00066
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CULC809_00066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AEG80607
LinkDB All DBs
Position
complement(70258..71856)
Genome map
AA seq 532 aa AA seqDB search
MFNPRNGLPVPPAWLETAIFYEIYPQTFYDSNGDGIGDVQGIVDKLDYIADLGANALWIN
PCFDSPFKDAGYDVRDYYTVAPRYGTNADLEKLFTEAHTRGIKVLLDLVPGHTSEQNDWF
QYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYILNFFKSQPALNYGFNKKT
RPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSLVKFDGEDKQETIKVWQKI
FARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGYNVLARNTDDPLGRSEDLSF
FKQSSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPRLAPRLTDAERRLFFIFLLTM
PGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDATKKNCGFSSAPTEELYLPQDT
APDAPDAASQMLDPAALRPFVQKLIGLRSQHPELHADSDFSFLWAHDNSRILAYRRESSG
GNRCAVALNAGDTADSITLESPATIIVSSGDARVEGNTVRLGPSSGAVVELA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaccctcgaaacggactcccagttcctcccgcatggcttgaaacggcgatcttt
tatgagatctatccgcaaactttctacgactctaacggtgatggaatcggcgacgtgcag
gggatcgtcgataagcttgattacatagctgaccttggcgcaaacgcgttatggatcaac
ccttgcttcgattccccctttaaagacgcaggatacgacgtccgcgattactacacagtc
gcacctcgctacggcaccaatgctgacctagaaaagctgttcactgaagcccacaccaga
gggattaaggttctactcgaccttgtccccgggcacaccagtgagcagaacgactggttc
cagtattcctgcaaagcggagcccaaccagtattcggatcgctacatctggacatctcac
gcctttgataacggcgacggcctccccttcatcggaggcgaggcgccccgcaatggcacc
tatatcctcaactttttcaagagccaaccggcactcaactacggttttaataagaaaaca
cgcccctggcagcaaagcgttgatgcccctggtccggtagccaaccaagaagagatggcc
aacatcatgcgctactggttggacaaaggcgcggacggtttccgagtagacatggccgat
tccttggtcaaatttgatggtgaagataaacaagaaaccatcaaggtgtggcagaaaatc
tttgcgagattccgcaatgactacccagaggcggcatttgtttcagaatggggtaaacct
attcaggcacttaaggccggctttgacatggacttctacctagattggcgcaacaacggc
tataacgtcttggcccgcaacacagacgatccgctagggcgcagcgaagacctcagcttt
ttcaagcagtcatccggaacctcaccgcaggagttcatcgaccaatactggccacaatat
gagcagatccgcgatcttggatacttcagcctgatctcttgtaatcatgacaccccccgt
cttgcgcctcgactcaccgatgccgagcgtcgccttttcttcatatttctgctgaccatg
cccggcgtccccttcatctactacggcgatgaaattggcatgcgctacctcgatattccg
accaaagagggcggataccaacgtactggtacccgcacaccaatgcagtgggatgcgaca
aagaaaaactgcggtttctccagcgcaccaacagaagagctgtatcttccacaagacaca
gctcctgatgccccggatgcagcctcgcaaatgttggaccccgcggcgttacgccccttc
gtgcaaaagctcatcgggctgcgatcgcaacacccagagctgcacgcagacagcgacttc
tctttcctgtgggcacacgataactcccgaatactcgcgtatcgcagagaatcctccggc
ggaaaccgctgcgcagtggcacttaacgctggcgacaccgcagatagcatcactctggaa
tctccggcgaccatcatcgtgagttccggcgacgcccgagtggaggggaataccgtgcgc
ttagggccttcctcgggagcagtggtggaattggcgtaa

DBGET integrated database retrieval system