KEGG   Corynebacterium ulcerans 0102: CULC0102_1089Help
Entry
CULC0102_1089     CDS       T02171                                 

Gene name
ddlA
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00473  D-Alanine metabolism
cue00550  Peptidoglycan biosynthesis
cue01100  Metabolic pathways
cue01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CULC0102_1089 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CULC0102_1089 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CULC0102_1089 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cue01011]
    CULC0102_1089 (ddlA)
Enzymes [BR:cue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CULC0102_1089 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cue01011]
 Precursor biosynthesis
  Amino acid ligase
   CULC0102_1089 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAM27288
LinkDB All DBs
Position
1148950..1150038
Genome map
AA seq 362 aa AA seqDB search
MVVTQNPSENPRVRVAVVYGGQSSEHSVSCVSAGAIMSHLDPEKYEVFPVGITRDGVWTV
GETDATKLRTVDRVMPEVEFVREVKLSVNPRSAGEFRYEDGTLYAHADVIFPALHGRFGE
DGTIQGMFELSGIPYVGTGVLSSACGMDKEYTKKLLAAEGLPVGKEVILRGDETLTDADK
HMLGLPVFVKPARGGSSIGISRVAEWDDFDAALTLAREHDTKVIVEAEIKGVEVECGVLE
RADGSLIASVPAQLEDVDEGEEGFYGFDTKYLDNVVTATIPAPFDEATTKLIQSLSLEAF
QALNCRGLSRVDFFITAQGPVLNEVNTMPGFTPISMYPQVFEATGIGYAELLSHLIDQAL
AQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggttgtgactcagaatccttccgaaaatccccgtgtcagggttgccgtagtttatggc
ggccaaagctcagagcattccgtttcctgcgtttctgccggggcgattatgtctcaccta
gacccagaaaaatacgaggtctttcccgtaggaatcacccgtgatggtgtgtggaccgta
ggggagaccgacgccaccaagctgcggactgtggaccgcgttatgccagaggtggagttt
gtccgtgaagtaaagctttccgtgaaccctcgttctgccggtgagttccggtatgaggac
ggaacgctgtacgcacatgccgatgtgattttcccggccttgcatggtcgatttggtgag
gacggaaccattcaaggaatgttcgagctttctggcattccttatgtgggaaccggagtg
ttgagttctgcctgtggcatggacaaggagtacaccaagaaacttcttgcggcggaaggc
ctgcccgtgggcaaagaagtgatccttcgtggggacgaaaccctcacagatgccgataag
cacatgctgggtctccctgtgtttgttaagcccgcacgaggcggatcatccatcggaatt
tcccgcgtagccgagtgggacgacttcgatgctgccctcaccctagcccgagagcatgac
accaaagtgatcgtggaagcggagattaaaggcgtagaagtagagtgcggcgtacttgag
cgtgccgacggctccctgatcgcttcagtgccggcacagctagaagacgttgatgaaggc
gaagaaggcttctatggttttgataccaaatacctagacaacgtagtcacagccaccatc
ccagcgccctttgatgaggcaacaactaagctcatccaatcgctatcgctagaggccttc
caagcactcaactgccgaggcctttctcgcgtggacttttttatcaccgcccaggggcca
gtgctcaatgaggtgaacacgatgccgggctttaccccgatttccatgtatccgcaggtg
tttgaggccaccgggatagggtatgcagagctgctctctcacctgatcgaccaggcgctg
gctcaataa

DBGET integrated database retrieval system