KEGG   Corynebacterium ulcerans 0102: CULC0102_1229Help
Entry
CULC0102_1229     CDS       T02171                                 

Gene name
hisE1
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00340  Histidine metabolism
cue01100  Metabolic pathways
cue01110  Biosynthesis of secondary metabolites
cue01230  Biosynthesis of amino acids
Module
cue_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CULC0102_1229 (hisE1)
Enzymes [BR:cue01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CULC0102_1229 (hisE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: BAM27428
LinkDB All DBs
Position
complement(1316791..1317054)
Genome map
AA seq 87 aa AA seqDB search
MKNFDSLYAELLDRARTRPENSGTVHALDSGVHTLGKKVIEEAGEVWLAAEYQSDDELAE
EISQLLYWAQVIMVKRGLTPEDVYKFL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacttcgactctttgtatgcagaactccttgatcgcgcccgcacccgtccagag
aattctggaactgtccacgccctcgattcgggagtgcatacccttggcaaaaaagtcatt
gaggaagccggagaagtatggctcgctgcagagtatcaatccgatgacgaattagcagaa
gaaatctcgcagctgctgtattgggcccaagtaatcatggttaaacggggtttgactccc
gaagacgtttataagtttctgtga

DBGET integrated database retrieval system