KEGG   Corynebacterium ulcerans 0102: CULC0102_2312Help
Entry
CULC0102_2312     CDS       T02171                                 

Gene name
puo
Definition
(GenBank) putrescine oxidase
  KO
K03343  putrescine oxidase [EC:1.4.3.10]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00330  Arginine and proline metabolism
cue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CULC0102_2312 (puo)
Enzymes [BR:cue01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.10  putrescine oxidase
     CULC0102_2312 (puo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 FAD_oxidored HI0933_like DAO FAD_binding_3 FAD_binding_2 Lycopene_cycl Pyr_redox_2 Pyr_redox_3 Pyr_redox AlaDh_PNT_C NAD_binding_9 GIDA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: BAM28510
LinkDB All DBs
Position
complement(2534661..2536145)
Genome map
AA seq 494 aa AA seqDB search
MTSPQKIESDVVVIGAGPSGLMAARTLKAQGLNVCVLEARARVGGRTWNGKVKDADGVEH
FIELGGQWISPDQTRLIELVSELGLDTFPRYREGKSVYVSPDGMRHVYQEEFPVSPTTAE
EMDRLIRELDQLTSEIDPASPWAHPRAKELDSISFRSWLEQLSSDTEAIDNVSIYVASGM
LTKPAHTFSVLQAALMAASAGSFSNLVDEDFILDKRVVGGMQSVSLAMAQELGDAVILDS
PVRRLEWATPDPDTADPLNGVLADVRNGVPNNGAPGNVTAYSDKAIVSARYAVLAIPPNL
YNRIDYVPPLPRDQQIVHQHISMGLVIKVHAVYPTPFWREEGLSGTGFGGGHLVQEIYDN
TNYGENCASGEPHKEDPYGTLVGFVSDVYAEDMWHLSASERKKRILEAMSMYLGPKTMEP
IAFYLSDMAAEEWTRGAYATSYDLGGLSRWGHLQNQPTGPIYYSCSDIAAEGYQHVDGAI
RMGEHVAHAIAARG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtccacaaaagatagaaagcgacgtagtagttattggggctggaccgtcagga
cttatggcagcccgcaccctcaaagcgcaaggactgaacgtgtgcgtgcttgaggctcgt
gctcgcgtgggtggtcggacctggaacggaaaagtaaaagacgctgacggcgtagaacac
tttattgagctaggcggacagtggatttccccagaccaaacgcggcttatagagctggtc
tcagagctgggattggacacgttcccccgctatcgcgagggaaaatcggtgtacgtgtcc
cccgatggcatgcgccatgtgtaccaggaagaattcccggtcagccccactacggcggag
gaaatggatcggcttatccgggaactcgatcagttgacctcggagatcgacccggcatcg
ccatgggcacatccgagggccaaagaactggactcgatttcttttcgcagctggttagag
cagctttctagcgataccgaggcgatcgacaacgtatccatctacgttgcctcgggcatg
ctcacaaagccggcacataccttttcggtattgcaggcggcgctcatggcggcgtcagca
ggctcttttagtaacctcgtagatgaagacttcatcttggataagcgtgttgtcggcgga
atgcagtcagtatcgctggccatggcgcaggaacttggcgacgccgtgattcttgactcg
cccgtacgccgcttagagtgggccactcccgatcctgatactgcagatccgctcaatgga
gtgcttgccgacgtccgcaacggggttcccaacaatggggctccgggaaacgtgactgca
tactcggacaaggcaatagtgagtgcccggtacgcggtgcttgccatccctccaaatctg
tacaacaggatcgattatgttccgccgctcccccgcgaccaacagatcgtgcatcaacac
atctccatggggctggttatcaaagttcatgcggtctacccgacgcccttctggcgtgaa
gaaggactatcaggaaccggttttggcggaggtcacctagttcaagagatctatgacaac
actaactatggcgagaattgcgcctcgggagaacctcacaaggaagacccatacggcacc
ctcgtaggctttgtctccgatgtctacgccgaggacatgtggcacctttctgcgtcggaa
cgcaaaaaacgcatccttgaggcgatgtccatgtacttggggcccaagaccatggaaccg
atagctttttatctttccgatatggctgcggaagagtggacgcgaggcgcctatgccacc
agctatgacctcggtggactttctcgttgggggcatctgcaaaaccaaccaaccggcccg
atctattactcgtgttcagacatcgctgctgaggggtaccagcacgtggacggggcgata
cgcatgggcgaacacgtcgcgcatgcgattgcggcgaggggctaa

DBGET integrated database retrieval system