KEGG   Curtobacterium sp. SGAir0471: C1N91_03455Help
Entry
C1N91_03455       CDS       T05978                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cug  Curtobacterium sp. SGAir0471
Pathway
cug00040  Pentose and glucuronate interconversions
cug00051  Fructose and mannose metabolism
cug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C1N91_03455
   00051 Fructose and mannose metabolism
    C1N91_03455
Enzymes [BR:cug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     C1N91_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 Pyr_redox_2 Pyr_redox_3 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: QCR42739
UniProt: A0A4P8SQ44
LinkDB All DBs
Position
736734..737780
Genome map
AA seq 348 aa AA seqDB search
MSTTPDTQRASVLLGTEDLTVEDRPVPEVAPGDVLVRVAAVGVCGSDVHYYRHGRIGDFV
VEEPLVLGHELSGTITAVGEGVDPGRVGERVAVEPQRPCHRCAQCLAGRYNLCPHMRFYA
TPPVDGAFAEYVTIEAEFAHTLPDSVSFEAGALLEPLSVGIAAARKAGIVPGSSVLIAGA
GPIGVICAQVARAFGATRVVVSDLVPERRERALSFGATTVVDPVAVDVTSDIVPVDAFID
ASGAPRAVSDGIKAVGPAGAAVLVGLGNSEMVLPVEHIQNLEVTVTGIFRYTNTWPVAIG
LVASGQVDLDALVTGRFGLDDVREALESDTDPASLKSVVYPNGVPAGE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacccccgacacccagcgcgcgagcgtcctgctcggcaccgaggacctgacg
gtcgaggaccgcccggtccccgaggtcgcccccggcgacgtcctcgtccgcgtcgccgcc
gtcggcgtgtgcggctccgacgtgcactactaccgccacggccgcatcggcgacttcgtc
gtcgaggagcccctcgtcctcggccacgagctctccggcacgatcaccgcggtcggcgag
ggcgtcgacccgggacgggtcggcgagcgcgtcgccgtcgaaccgcagcgtccgtgccac
cgttgcgcgcagtgcctggccggccgctacaacctctgcccccacatgcgcttctacgcg
acgccccccgtcgacggcgccttcgccgagtacgtcacgatcgaggccgagttcgcgcac
accctgcccgactcggtgtccttcgaggcgggcgcactgctcgaaccgctgtccgtcggc
atcgccgccgcgcgcaaggcagggatcgtccccggctccagcgtcctcatcgccggcgcc
ggaccgatcggcgtcatctgcgcccaggtcgcccgggcgttcggcgcgacgcgcgtggtc
gtcagcgacttggtccccgagcgccgcgagcgcgcgctgtcgttcggcgccacgacggtc
gtcgaccccgtggcggtggacgtcacgtcggacatcgtccccgtcgacgccttcatcgac
gccagcggtgcgccgcgcgccgtgtcggacggcatcaaggccgtcggacccgcgggggcc
gcggtgctcgtcggcctcggcaactccgagatggtgctgccggtggagcacatccagaac
ctcgaggtgacggtcaccggcatcttccgctacacgaacacgtggccggtcgccatcggc
ctggtcgcctccggccaggtcgacctcgacgcgctcgtcaccggacgcttcggcctcgac
gacgtccgcgaggccctcgagagcgacaccgacccggcctcgctcaagtcggtggtctac
ccgaacggtgtccccgcgggagagtga

DBGET integrated database retrieval system