KEGG   Cupriavidus necator NH9: BJN34_05835Help
Entry
BJN34_05835       CDS       T05121                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJN34_05835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cuh02000]
    BJN34_05835
Enzymes [BR:cuh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJN34_05835
Transporters [BR:cuh02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJN34_05835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_C GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AQV93413
UniProt: A0A1U9UL67
LinkDB All DBs
Position
1:1267955..1268596
Genome map
AA seq 213 aa AA seqDB search
MLKLCGFAASNYYNKVKLALLEKNVPFEEVLAWIGQTDPAATPAGKVPYIITESGPLCES
EAIVDYVEAAYPQTPLLPRDPFQAAKVREIVVFMELYLELTARELYPEAFFGGKVSDSVK
ERQHKLLSRYVPAFARLAKFSPYIAGDSFTLADCAAAVHLPLVSSCTKIIYGTDLLADLP
VKDYLKTLSARESVQKVNADRKANLELMMSKNK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagctctgcggctttgccgccagcaactactacaacaaagtgaagctggcgctg
ctggaaaagaacgtgccgttcgaagaagtgctggcctggatcggccagaccgacccggcg
gccacgcccgcgggcaaggtgccctacatcatcaccgaatccggcccgctgtgcgagtcc
gaagcgatcgtcgactatgtggaggcggcttatccgcagacgccgctgctgccgcgcgac
ccgttccaggccgccaaggtgcgcgagatcgtcgtcttcatggaactgtacctggagctg
accgcgcgcgagctgtaccccgaggccttcttcggcggcaaggtcagcgacagcgtcaag
gagcgccagcataagctgctgtcgcgctatgtcccggccttcgccaggctggcgaagttc
tcgccgtatatcgccggcgacagcttcacgctggccgactgcgccgccgcggtgcacctg
ccgctggtgtcgtcgtgcaccaagatcatctacggcaccgacctgttggcggacctgccg
gtcaaggactatctgaagacgctgtcggcgcgtgagtcggtgcagaaggtcaatgccgac
cgcaaggccaatctcgagctgatgatgagcaagaacaagtaa

DBGET integrated database retrieval system