KEGG   Cupriavidus necator NH9: BJN34_08700Help
Entry
BJN34_08700       CDS       T05121                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
cuh  Cupriavidus necator NH9
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cuh03400]
    BJN34_08700
Enzymes [BR:cuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BJN34_08700
DNA repair and recombination proteins [BR:cuh03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BJN34_08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 P63C
Motif
Other DBs
NCBI-ProteinID: AQV93970
UniProt: A0A1U9UMZ8
LinkDB All DBs
Position
1:1907580..1909946
Genome map
AA seq 788 aa AA seqDB search
MALQQGFILTRHWRDTPAGTEVEVWLATDDGPRRLRLSCQPSVAFIPEAQRERAEALLGR
ERDVELRPLKLQDFQRRPVVGLYCQQHRQLIQLSRALRDAGVDVYEADIRPPERYLMERF
ITAPVWFDGEPDASGVLRNAQMKPSVDYRPTLRLVSLDIETNAFGELYSIALEGCGQCQV
YMLGPAPQTPADVDFSLEYCATRPALLAKLNQWLAEHDPDAIIGWNLVQFDLRVLHEHAR
KFQVPLRLGRGGAEMEWREHNAQQHYFASAAGRLIIDGIEALRSATWTFPSFSLESVAQT
LLGEGKAIDDPYHRMDAIDRMFEQDKPALARYNLRDCELVTRIFEKTELLPFLLERATVT
GLPADRSGGSVAAFTHLYMPLMHRQGYVAPNLGDKAPEASPGGFVMDSRPGLYESVLVLD
YKSLYPSIIRTFLIDPIGLVEGLAHPDDADSVPGFRGARFSRTKHCLPAIVARVWQGREA
AKRDRNKPLSQALKIIMNAFYGVLGSSGCRFFDARLASSITMRGHEIMRQTRALIEARGY
EVIYGDTDSTFVWLRRARTEADANQIGRSLVAYVNDWWRDHLWQTHGLESALELQFETHF
RRFLMPTIRGTDLGSKKRYAGQVERPDGKVEMVFKGLETVRTDWSPLAQRFQQTLYEKIF
NREPYADYVRDIVRRTLAGELDEQLVYRKRLRRKLDDYQRNVPPHVRAARIADDYNERHG
RPRQYQQGGWISYVMTLSGPEPLEARSAPIDYNHYVTKQLQPIADAILPFLEDGFETLLT
GQMALFPQ
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
gtggcacttcagcagggctttatcctgacccgacattggcgcgacacgccggccggcacc
gaggtcgaggtctggctcgccaccgatgacggaccgcgccggctgcgcctgtcctgccag
ccgtcagtggcgtttatccccgaggcacagcgtgagcgcgccgaggcgctgctgggccgc
gagcgcgatgtcgaactgcgcccgctcaagctccaggatttccagcgcaggcccgtagtg
ggcctgtactgccagcagcatcggcaactgatccagctcagccgcgctttgcgcgatgcc
ggcgtggatgtctacgaggccgatatccgcccgcccgagcgctacctgatggagcgcttc
atcaccgccccggtctggttcgacggtgagccggatgccagcggcgtgctgcgtaatgcc
cagatgaagccgtcggtggactaccggcccacgctgcgcctggtctcgctcgatatcgaa
accaacgcgtttggcgaactctattcgattgcgctcgagggctgcggtcagtgccaggtc
tacatgttgggcccggcaccgcagacgcccgccgacgtcgatttctcgctcgaatattgc
gcaacacgtcccgcattgctggcgaagctgaaccaatggctggccgagcacgatcccgac
gcgatcattggctggaatctggtccagttcgacctgcgcgtgctgcacgagcatgcacgc
aagttccaggttccgctgcgcctgggccgcggcggtgccgaaatggaatggcgcgagcac
aacgcccagcagcactatttcgccagcgcggcggggcggttgatcatcgacggcatcgag
gcgctgcgttcggccacgtggaccttcccgtcgttcagcctggaatcggtggcacagacc
ctgctcggcgagggcaaggcgatcgacgacccgtaccaccgcatggacgccatcgaccgc
atgttcgaacaggacaagccggcgctggcccgctataacctgcgcgattgcgaactggtg
acgcggatcttcgaaaagacggagctgctgccattcctgctggagcgcgccacggtcacg
ggcctgccggccgaccgcagcggcggctcggtcgccgccttcacgcatctctacatgccg
ctgatgcatcgccagggctacgtcgcgcccaacctcggcgacaaggcacccgaggccagc
cctggcggcttcgtcatggactcgcggccagggctctacgaatcggtgctcgtgctggac
tacaagagcctctacccgtcaatcatccgtaccttcctgatcgacccgatcggcctggtc
gagggcctggcgcatccggacgatgccgattcagttcctggcttccgcggtgcgcggttt
tcccggacgaagcactgcctgccggcgatcgtcgccagggtctggcaagggcgtgaagcc
gccaagcgagaccggaacaagccgctttcccaggcgctcaagatcatcatgaacgcgttc
tacggcgtgctcgggtccagcggctgccgcttcttcgatgcgcggctggcatcgtcgatc
accatgcgcgggcacgagatcatgcggcagacccgggcgctgatcgaggcccgcggctac
gaggtgatctatggcgacacggattccaccttcgtctggctgcgccgcgcccggacggag
gccgacgccaaccagatcggccgcagcctagtcgcctacgtcaacgactggtggcgcgac
cacctctggcagacccatggcctggaaagcgcgctcgaactccagttcgaaacgcacttc
cggcgcttcctgatgccgaccatccgcggcacggaccttggcagcaagaagcgctatgcc
ggccaggtggaacgccccgacggcaaggtcgagatggtcttcaaggggcttgagacggtg
cgtacggactggtcgccgctcgcccagcggttccagcagaccctctacgaaaagatcttc
aaccgcgagccgtacgcggactatgtgcgggacatcgtgcgccgcaccctggccggcgag
ctcgacgagcaactggtctatcgcaagcggctgcgccgcaagctcgatgattaccagcgc
aacgtgccgccgcacgtgcgggctgcccgtatcgccgatgactataacgagcgccacggg
cggccgcgccagtatcagcagggcggctggatcagctatgtgatgaccctgtcagggccg
gagccgctcgaggcacggtcggcgccgatcgactataaccactacgtgacaaagcagctc
cagccgattgcggatgcgatcctgccattcctggaggacggcttcgagaccctgctgacc
gggcagatggcgctttttccgcaatag

DBGET integrated database retrieval system