KEGG   Cupriavidus necator NH9: BJN34_12190Help
Entry
BJN34_12190       CDS       T05121                                 

Definition
(GenBank) DNA polymerase III, subunit gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh03030  DNA replication
cuh03430  Mismatch repair
cuh03440  Homologous recombination
Module
cuh_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BJN34_12190
   03430 Mismatch repair
    BJN34_12190
   03440 Homologous recombination
    BJN34_12190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cuh03032]
    BJN34_12190
   03400 DNA repair and recombination proteins [BR:cuh03400]
    BJN34_12190
Enzymes [BR:cuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BJN34_12190
DNA replication proteins [BR:cuh03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BJN34_12190
DNA repair and recombination proteins [BR:cuh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BJN34_12190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA DNA_pol3_tau_5 RuvB_N AAA_16 AAA_18 AAA_5 AAA_22 AAA_14 DUF3646 TsaE Mg_chelatase AAA_24 Herpes_Helicase SKI T2SSE AAA_28
Motif
Other DBs
NCBI-ProteinID: AQV94647
UniProt: A0A1U9UQF2
LinkDB All DBs
Position
1:complement(2676125..2678449)
Genome map
AA seq 774 aa AA seqDB search
MSYQVLARKWRPRDFTTLVGQEHVVRALTHALEQQRLHHAYLFTGTRGVGKTTLSRILAK
ALNCTGPDGNGGITAQPCGQCKACQEIDSGRFVDYIEMDAASNRGVDEMAQLLDKAVYAP
TSGRFKVYMIDEVHMLTNHAFNAMLKTLEEPPGHVKFILATTDPQKIPVTVLSRCLQFNL
KQMPPGHIVSHLDHILAQEGIAHDGNALRLLAQAAHGSMRDALSLTDQAIAYSAGQVSED
AVRGMLGAIDQGYLVQLLDALAAEDGAAMLAIADAMADRSLSFAGALQDLGSLLHKVALA
QAVPASVQDEWPEADEVRRLAGVFDAQEVQLFYQIANLGRSELALAPDEYAGFTMTLLRM
LAFRPSAEPITTQGQGGGAAPACQRGTAALEAARPVDTRQATPVADAAAPARAVAAPPPA
AVPVRAVQPAPVAEPAAAPATAPASAEAAPARPATGAMSPAAAALAAARQGSAARGGGAR
KTPPPAMPDAPAAAQRPPAQPLRAPGAAAVSRPPAAPAPVAKASMPSPVQSPAPAARPAA
RQPEPESLPPWELAGGSDVPPWEELPPDLPVIGPYDSDPGYSDHGFNEPAPRAAAPRNGA
ARPARAPAREAEPAREAAAPAMQPAAAPAESARFVAPRPPAAGEDGTPPAFTGEWPVLAA
GLPLKGLAQQLAYQSELTQVVGRTFHLRIPVAALGENGVAERLQQALCDHFGEPVRVVCE
VGGVSVTAAAADAEARAERQRQAEAVIEADPFVQGLLRDFGGQIVPGSIQPRAA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcaagttctagcgcgcaaatggcgccccagggatttcaccacgctggtcggc
caggagcacgtggtccgcgcgctcacgcacgcgctggaacagcagcggctgcaccacgcc
tacctgttcaccggcacgcgcggagtcggcaagaccacgctgtcgcggatcctggccaag
gccctgaactgcaccggccctgacggcaatggcggcatcaccgcccagccgtgcggccag
tgcaaggcctgccaggagatcgacagcggccgcttcgtcgactacatcgagatggacgcc
gcctccaaccgcggcgtcgacgagatggcgcagctgctggacaaggcggtctacgccccg
acctccgggcgcttcaaggtctacatgatcgacgaagtgcacatgctgaccaaccacgcc
ttcaacgccatgctgaagacgctggaggagccgcccgggcacgtcaagttcatccttgcc
accaccgacccgcagaagatcccggtcacggtgctgtcgcgctgcctgcagttcaacctg
aagcagatgccgccggggcatatcgtctcccacctggaccatatcctggcgcaggaaggc
attgcccacgacggcaacgcgctgcggctgctggcccaggccgcgcacggctcgatgcgc
gatgcgctgtcgctgaccgaccaggccatcgcctacagcgccggccaggtgtcggaagac
gcggtgcgcggcatgctgggcgcgatcgaccagggctacctggtgcagctgctcgacgcg
ctcgccgccgaagacggcgccgccatgctggcgattgccgatgccatggccgaccgcagc
ctgtcgtttgccggcgcgctgcaggacctgggctcgctgctgcacaaggtggcgctggcg
caggccgtgccggcctcggtgcaggacgaatggcccgaagccgacgaggtgcggcgcctg
gccggcgtgttcgacgcgcaggaagtgcagctgttctaccagatcgccaacctgggccgc
agcgagctggcgctggcgccggacgagtacgccggcttcaccatgacgctgctgcgcatg
ctggcgttccggccgtcggccgagccaatcacgacgcaagggcagggtggcggcgccgcg
cctgcgtgccagcgcggcactgcggcgctggaagccgcccgtccggttgatacccgtcag
gcgacgcctgtagccgatgccgccgcgccggccagggccgtcgccgcaccgccgcctgcc
gctgtgccggtacgggcggtgcagcccgcgcccgtggccgaacctgccgcggcgccggcc
acggcgcctgcatccgctgaagcggcgccggcgcgtccggcaaccggggccatgtcgccc
gctgccgccgcactggccgctgcccgccagggttccgccgcgcgcggcggcggtgcccgc
aagacccctccgccggccatgccggacgcaccggctgccgcgcagcgcccgccggcccag
cccttgcgcgcacccggcgcggcagccgtaagccgcccgccggcagcgccggcgccggtt
gcgaaggcgtccatgccgtcgccagtccagtcgcccgcgccggcggcacgacccgcggcg
cgccagccggagccggaatccttgccgccctgggagttggcgggtggcagcgacgtgccg
ccgtgggaagaactgccgcctgacctgccggtcatcggcccctatgacagcgatcccggc
tacagcgaccacggattcaacgaaccggcaccgcgtgccgccgcgccgcgcaacggcgcc
gcccggccggccagggcacccgcgcgtgaggccgagccggcccgcgaggccgctgcccct
gccatgcagccggccgcggcgcccgcggagtccgccagattcgtcgccccgcgcccgcct
gcggcgggcgaggatggcaccccgccggccttcaccggcgaatggccggtgctggccgcc
ggcctgcccctgaagggcctggcgcagcaactggcctaccagagcgaactgacccaggtg
gtcgggcgtaccttccacctgcgcatcccggtcgcggccctgggcgagaacggcgtggcc
gagcggctgcagcaggcgctgtgcgaccacttcggcgaacccgtgcgcgtggtctgcgag
gtgggcggggtttccgtcaccgcggcggccgccgatgccgaggcccgcgccgaacgccag
cgccaggccgaggccgtgatcgaggccgatcccttcgtgcaggggctgctgcgcgacttt
ggcggccagatcgtgccgggctcgatccagccgcgcgctgcctga

DBGET integrated database retrieval system