KEGG   Cupriavidus sp. NH9: BJN34_13450Help
Entry
BJN34_13450       CDS       T05121                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cuh  Cupriavidus sp. NH9
Pathway
cuh00564  Glycerophospholipid metabolism
cuh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJN34_13450
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BJN34_13450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AQV94886
UniProt: A0A1U9UQ00
LinkDB All DBs
Position
1:2935349..2936953
Genome map
AA seq 534 aa AA seqDB search
MQRIPTPIQPPKRAALLATLEREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQMFDQP
FYGIGLKVYDMLAGNLNLAGSRWLNHREVLAAAPNLAEHVGGRPLRGGNLYFDGQFDDAR
LAVALMRTLFDVGGTAINYMRVTGLSQQGGVISGVTVQDALGDASFRLRADCVINATGVW
VDAIRQMEDGHARAMVAPSQGVHLTLPRSFLPGERAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRRDLPLEPDAGADDVDFILETASRYLAKDPTRADVTSVWAGLRPLVRATGEASTA
SLSREHTILVSRAGLITVTGGKWTTYRKMAEDVIETAIQRQMVRAAPCVTAELPLHGAAG
LPAELPPTDSGSPDRYYGNELEMLRALPGHDRVLAPASGLTEAHVRFAARHELARRVEDV
LARRNRALFLDARAAVEAAPAVAAILAEELGEDEAWQAREVESFRTLAAGYMLG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaattcccaccccgatccagccacctaagcgcgccgccctgctcgccaccctt
gagcgcgagccgcgctgggacgtgatcgtcatcggcggcggcgccaccggcctgggcacg
gcagtcgatgccgcctcgcgcggctaccgcacgctgctggtcgaagccgcggactttgcc
aagggcacttccagcaaggccaccaagctggtgcatggcggcgtgcgctacctggcccag
ggcaatatcagcctggtgcgcgaggccctgcacgagcgcggcctgctcgcgcgcaacgcg
ccgcacctggtgtggccgctgggcttcgtggtgccggcctaccagatgttcgaccagccc
ttctacggcatcggcctgaaggtttatgacatgctggccggcaacctgaacctggccggc
agccgctggctgaaccaccgcgaagtgctggccgcggcgcccaacctggccgagcatgtc
ggcgggcgtccgctgcgcggcggtaacctgtatttcgacggccagttcgacgatgcgcgg
ctggcggtggcgctgatgcgcaccctgttcgacgtgggcggcaccgcgatcaactacatg
cgcgtgacgggcttaagccagcaaggcggcgtgatcagcggcgtgacggtgcaggatgcg
ctcggagacgccagcttccggctgcgcgcggactgcgtgatcaatgccacgggcgtgtgg
gtcgatgccatccgccagatggaagacggccatgcccgcgccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcagcttcctgccgggcgagcgcgccatcctgatcccc
aagaccgacgacggccgggtactgttcgtggtgccctggaacggccacaccatcgtcggc
accaccgacacgccgcgccgcgacctgccgctggagcccgacgccggtgccgacgatgtc
gatttcatcctggaaaccgcgtcgcgctacctggccaaagacccgacccgtgccgacgtc
accagcgtctgggccggcctgcggccgctggtgcgcgccaccggcgaggcctccaccgcg
tcgctgtcgcgcgaacataccatcctggtgtccagggccgggctgatcaccgtcaccggc
ggcaagtggaccacctaccgcaagatggccgaagacgtgatcgaaaccgcgatccagcgc
cagatggtgcgcgcggctccgtgcgtgaccgcggaattgccgctgcacggcgccgcgggc
ttgcccgccgagctgccgccgacggattctggctcaccggaccgctactacggcaacgag
ctggaaatgctgcgcgcgctgcctggccacgaccgcgtgctggcgccggcatcgggcctg
accgaagcccatgtgcgctttgccgcccggcatgaactggcccgccgggtcgaggacgtg
ctggcccgccgcaaccgcgcgctcttcctggatgcccgggcggccgtcgaagccgccccg
gccgtggccgcgatcctggccgaggagctcggcgaggacgaagcctggcaggcgcgcgaa
gtcgaaagcttccgcacgctcgccgccgggtacatgcttggctga

DBGET integrated database retrieval system