KEGG   Cupriavidus necator NH9: BJN34_15635Help
Entry
BJN34_15635       CDS       T05121                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00620  Pyruvate metabolism
cuh00680  Methane metabolism
cuh00710  Carbon fixation in photosynthetic organisms
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
cuh01200  Carbon metabolism
Module
cuh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJN34_15635
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJN34_15635
   00680 Methane metabolism
    BJN34_15635
Enzymes [BR:cuh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJN34_15635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AQV95310
UniProt: A0A1U9URS2
LinkDB All DBs
Position
1:3384666..3387707
Genome map
AA seq 1013 aa AA seqDB search
MTQHAARPNGPSGRKTAPAAKDPSAAKGDVTGATTAKPTRSAPRAAKRSTKPKLSIVSSN
GTTIATPARRTVDKDVPLREDIRFLGRLLGECLREQEGDAAFEVVETIRQTAVRFRREND
RAAGAELDRLLKRLSRDQTNQVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQAGSL
QHALESIDAAGVTGKQLRKFLDEALIVPVLTAHPTEVQRKSILDAEREIARLLAERDLPM
TAREREHNTAQLRAKVTTLWQTRMLRDARLTVADEIENALSYYRTTFLRGIPQLMSELEE
DIAAVFPATRKRKGTPGASGTKAAPLAPFLQMGSWIGGDRDGNPNVTADTLEHAASQQGQ
MILDWYLDEVHALGAELSMSTLMVDASPELLALAERSPDHSEHRADEPYRRALIGIYARL
AATSKALTGHAVPRRPVAPAEPYDSAEAFAADVQVVIDSLRANHGEALANGRIDALARAI
AVFGFHLASVDMRQVSDVHEAVIAELFAAAGIAPDYAALPEARKLELLLAELRQPRLLTL
PWHEYSEQTRKELAIFAAARELRARYGKRIARNYIISHTETLSDLIEVMLLQKESGMLQG
TLGSKTDPARMELMVIPLFETIEDLRNAAGIMQSLLDLPGFDSVIAHHGVEQEVMLGYSD
SNKDGGFLTSTWELYKAELALVQLFEQRKVKLRLFHGRGGTVGRGGGPTYQAILSQPPGT
VNGQIRLTEQGEIINSKFANAEIGRRNLETVVAATLEASLLPQQNAPKDLDTFEAVMQQL
SDRAFTSYRDLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIP
WGFSWGQCRLLLPGWYGFGSAVRSLLDSAPDDKARKQAVTTLRRMVKTWPFFSTLLSNMD
MVLAKTDLAVASRYAQLCDDAALRRNVFNRISKEWHLTCEMLALITGHQERLADNPLLAR
SIKNRFAYLDPLNHLQVELLKRYRSGKDGDDIRVRRGIHLTINGVAAGLRNTG
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcatgctgcgcgccccaacggcccgtctggtcggaagaccgctccggccgcg
aaagatccgtccgccgcaaaaggtgacgtaaccggcgcaaccaccgccaaacccacccgt
tccgccccccgcgcagccaagcgctccaccaagcccaagctttcgatcgtgtcgagcaac
ggaaccaccatcgccactcccgcccgccgcaccgtcgacaaggacgtgccgctgcgcgag
gacatccgcttcctgggccgcctgctgggcgaatgcctgcgcgaacaggaaggcgacgcc
gccttcgaagtggtcgagaccatccgccagaccgcggtgcgctttcgccgcgagaacgac
cgtgccgccggcgcggagctggaccgcctgctcaagcgcctgtcgcgcgaccagaccaac
caggtggtgcgcgccttcagctatttctcgcacctggccaatatcgccgaggaccagcac
cacaaccgccgccgccgcgtgcacgcgctggccggctcgccgccgcaggccggcagcctg
cagcacgcgctggagtcgatcgacgccgccggcgtgaccggcaagcagttgcgcaagttc
ctggacgaggcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtccagcgcaag
agcatcctggacgccgagcgcgagatcgcgcgcctgctggccgagcgcgacctgccgatg
accgcgcgcgagcgcgagcacaacaccgcgcagctgcgcgccaaggtcaccacgctgtgg
cagacccgcatgctgcgcgacgcgcgcctgacggtggccgacgagatcgagaacgcgctg
tcgtactaccgcaccaccttcctgcgcggcatcccgcagctgatgagcgagctggaagaa
gacatcgccgcggtgttcccggccacgcgcaagcgcaagggcaccccgggcgcctcgggc
acgaaggcggcgccgctggcgccgttcctgcagatgggttcctggatcggcggcgaccgc
gacggcaacccgaacgtcaccgccgatacgctcgagcacgccgccagccagcaggggcag
atgatcctggactggtacctcgatgaagtccacgcgctgggcgcggagctgtcgatgtcg
acgctgatggtcgatgccagccccgaactgctggcgctggccgagcgctcgcccgaccac
tccgagcatcgcgccgacgaaccctaccgccgcgcgctgatcggcatctatgcgcgcctg
gccgcaaccagcaaggcgctgaccggccacgccgtgccgcgccgcccggtggcgccggcc
gagccctatgacagcgccgaggcctttgccgccgacgtgcaggtggtgatcgactcgctg
cgcgccaatcacggcgaggcgctggccaatggccgcatcgacgccctggcacgcgccatc
gccgtgttcggcttccacctcgcgtcggtcgatatgcgccaggtctcggacgtgcacgag
gcggtcatcgccgaactgttcgcggccgccggcatcgcccccgactacgccgccctgccc
gaggcgcgcaagctggaactgctgctggccgagctgcgccagccgcgcctgctgacgctg
ccgtggcacgagtactcggagcagacccgcaaggaactggcgatcttcgccgccgcgcgc
gaactgcgtgcgcgctatggcaagcgcatcgcgcgcaactacatcatctcgcataccgag
accctgtcggacctgattgaggtgatgctgctgcagaaggaatccggcatgctgcagggc
acgctgggcagcaagaccgacccggcgcgcatggagctgatggtgatcccgctgttcgag
accatcgaggacttgcgcaatgcggccggcatcatgcagtcgctgctggacctgccgggt
ttcgattcggtgatcgcgcaccatggggtcgagcaggaagtgatgctcggctactcggat
tcgaacaaggacggcggcttcctgacctcgacctgggagctgtacaaggccgagctggcg
ctggtgcagctgttcgagcagcgcaaggtcaagctgcgcctgttccacggccgcggcggc
accgtgggccgcggcggcggcccgacctaccaggccatcctgtcgcagccgccgggcacg
gtgaacggccagatccgcctgaccgagcagggcgagatcatcaacagcaagttcgccaac
gccgagatcggccggcgcaacctggaaacggtggtcgccgccacgctggaggcctcgctg
ctgccgcagcagaacgcgccgaaggacctggacaccttcgaggccgtgatgcagcagctg
tcggaccgcgccttcacgtcctaccgcgacctcgtctacgagaccccgggcttcaaggac
tacttcttcgccactacgccgatcaccgagatcgccgacctgaacctgggttcgcgtccg
gcctcgcgcaagctgatggacaagaagcaccgccgcatcgaagacctgcgcgcgattccc
tggggcttctcgtggggccagtgccgcctgctgctgccgggctggtatggctttggcagc
gcggtcaggtcgctgctggacagcgcgccggacgacaaggcccgcaagcaggccgtgacc
acgctgcgtcgcatggtcaagacctggccgttcttctcgacgctgctgtccaacatggac
atggtgctggccaagaccgacctggcggtggcctcgcgctacgcccagctgtgcgacgac
gccgcgctgcgccgcaacgtgttcaaccgcatcagcaaggaatggcacctgacctgcgag
atgctggccctgatcaccggccaccaggaacggctggcggacaacccgctgctggcgcgc
tcgatcaagaaccgctttgcctacctcgacccgctgaaccacttgcaggtcgagctgctc
aagcgctaccgctcgggcaaggacggcgatgatatccgcgtgcggcgcggtatccacctg
accatcaacggcgtcgcggcgggcctgcgcaatacgggctga

DBGET integrated database retrieval system