KEGG   Cupriavidus necator NH9: BJN34_17530Help
Entry
BJN34_17530       CDS       T05121                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00473  D-Alanine metabolism
cuh00550  Peptidoglycan biosynthesis
cuh01100  Metabolic pathways
cuh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJN34_17530
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJN34_17530
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJN34_17530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuh01011]
    BJN34_17530
Enzymes [BR:cuh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJN34_17530
Peptidoglycan biosynthesis and degradation proteins [BR:cuh01011]
 Precursor biosynthesis
  Amino acid ligase
   BJN34_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST RimK ATP-grasp_4 CPSase_L_D2 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AQV95685
UniProt: A0A1U9UU46
LinkDB All DBs
Position
1:complement(3800752..3801735)
Genome map
AA seq 327 aa AA seqDB search
MSFVAHPNIDPKSLGKVGVLLGGRSAEREISLMSGNGVLAALQSRGVDAHGFDPGLQGVA
ELAAAGFDRVFIALHGRYGEDGTIQGLLEQLGVPYTGSGVLASAMAMDKQATKRLWMTHD
LATPRFAMLHADTDLDAVAADLGLPLIVKPAREGSSIGLTKVTAADQMRAAFEKAAALDN
DVIAETFIDGAELTCPIVGEGDTAEALPVIRIVAPEANYDYQNKYFTDDTQYLCPSGLDP
EVEREVQALAVQAYRVLGCRGWARADVMLRADGKPFLLEMNTSPGMTGHSLVPMAARAVG
ISYEDFVMQVVAAATLDLHPNGHWKPE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgtcgcccatcccaatatcgatcccaaatcgctgggcaaggtcggcgtgctg
ctgggcgggcgctcggccgagcgcgagatctcgctgatgtcgggcaacggcgtgctggcc
gcgctgcagtcgcgcggcgtggacgcgcatggcttcgacccgggcctgcagggcgtggcc
gagctggccgcggccggctttgaccgcgtcttcattgcgctgcacggccgctacggcgag
gacggcaccatccagggcctgctcgagcagctgggcgtgccgtacaccggcagcggcgtg
ctggcctcggccatggccatggacaagcaggccaccaagcgcctgtggatgacccacgac
ctggccacgccgcgctttgccatgctgcatgccgacaccgacctcgacgccgtggccgcc
gacctgggcctgccgctgatcgtcaagccggcgcgcgagggctcgtcgatcggcctgacc
aaggtcaccgcggcggaccagatgcgcgcggccttcgagaaggccgcggcgctggacaat
gacgtcatcgccgagacctttatcgacggcgccgagctgacctgcccgatcgtgggcgag
ggcgacaccgccgaagcgctgccggtgatccgcattgtcgcgcccgaagccaactacgac
tatcaaaataagtactttactgacgatacccagtacttgtgcccgtcgggcctggaccct
gaagtcgaacgcgaagtccaggcgctggcggtgcaggcctaccgcgtgctgggctgccgc
ggctgggcgcgcgccgatgtgatgctgcgcgccgacggcaagcctttcctgctcgagatg
aatacctcgcccggcatgaccggccattcgctggtgccgatggcggcgcgcgcggtcggc
atcagctacgaggacttcgtgatgcaggtggtggccgccgcaacgctggacctgcatccg
aacgggcattggaaacccgaataa

DBGET integrated database retrieval system