KEGG   Cupriavidus sp. NH9: BJN34_27225Help
Entry
BJN34_27225       CDS       T05121                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cuh  Cupriavidus sp. NH9
Brite
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BJN34_27225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu RskA Big_3_5
Motif
Other DBs
NCBI-ProteinID: AQV97558
UniProt: A0A1U9UXW1
LinkDB All DBs
Position
2:complement(1597486..1598061)
Genome map
AA seq 191 aa AA seqDB search
MKQVLTPLAACIAAAVALAGCAGSGMTSSSAASATAAPSPGAGARATAKLQPKSGTDTAG
TVTFQQQPGGVMMTAAITGLPPNSVHGFHVHEKGDCSAPDAMSAGGHFNPTGKPHGQMTV
PDHHAGDMNNVTADASGNARVSMLLPDLTVGTGANGVIGRAVVVHKDPDDYKTQPTGNSG
GRIACGVVAAS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtgcttacccccctggcggcgtgcattgccgcagccgttgcactggccggc
tgcgccggctccggcatgacctcctcgtctgcggccagcgcgaccgccgcgcccagccct
ggcgctggcgccagggcgacggcaaagctccagcccaagagcggcaccgacaccgcgggc
accgtgacgttccagcagcagcctggcggcgtgatgatgaccgccgcgatcacaggcctg
ccgccgaactcggtgcacggcttccacgtccatgaaaagggcgactgctccgcgcctgat
gcgatgagcgcgggcggccacttcaacccgaccggcaagccccatggccagatgaccgtg
cccgaccaccatgccggcgacatgaacaatgtcaccgcagacgccagcggcaatgcgcgc
gtcagcatgctgctgccggacctgacggttggcacgggcgccaacggcgtgatcggacgt
gcggtggtggtgcacaaggatccggacgactacaagacgcagcccaccgggaattcgggc
gggcggatcgcttgcggggtggtggcggcttcgtaa

DBGET integrated database retrieval system