KEGG   Cupriavidus necator NH9: BJN34_31420Help
Entry
BJN34_31420       CDS       T05121                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00630  Glyoxylate and dicarboxylate metabolism
cuh00710  Carbon fixation in photosynthetic organisms
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
cuh01200  Carbon metabolism
Module
cuh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cuh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJN34_31420
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJN34_31420
Enzymes [BR:cuh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BJN34_31420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AQV98386
UniProt: A0A1U9V087
LinkDB All DBs
Position
2:complement(2528060..2528479)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTDAQITSQLEYCLNQGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
IRYSIESYAVQARPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggcactttctctttcctgcccgacctcaccgacgcccagatcacc
agccagctcgaatactgcctgaaccagggctgggcggtcggcatcgagtacaccgacgac
ccgcatccgcgcaatacctactgggagatgttcggccttccgatgttcgacctgcgcgat
gccgccggcatcctgctggagatcaacaacgcgcgcagcaccttccccaaccactacatc
cgcgtcacggccttcgattcgacgcatacggtggagtcggtggtgatgtcgttcatcgtc
aaccgtcctgccgacgagcccggcttccgcctggtgcggcaggaagagcccggccgcacg
atccgctattcgatcgagagctacgccgtgcaggcgcgccccgagggcagccgctactga

DBGET integrated database retrieval system