KEGG   Cupriavidus sp. NH9: BJN34_31425Help
Entry
BJN34_31425       CDS       T05121                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cuh  Cupriavidus sp. NH9
Pathway
cuh00630  Glyoxylate and dicarboxylate metabolism
cuh00710  Carbon fixation in photosynthetic organisms
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
cuh01200  Carbon metabolism
Module
cuh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cuh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cuh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJN34_31425
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJN34_31425
Enzymes [BR:cuh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BJN34_31425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AQV98387
UniProt: A0A1U9V165
LinkDB All DBs
Position
2:complement(2528528..2529988)
Genome map
AA seq 486 aa AA seqDB search
MNAPESVQAKPRKRYDAGVMKYKEMGYWDADYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMIDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTHTDL
TRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDISFNYTPTDTSDFV
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgaatcggtccaagccaagccgcgcaagcgctatgacgccggcgtcatg
aagtacaaggaaatggggtactgggacgcggactatgagcccaaggacaccgacctgctg
gcgctgttccgcatcacgccgcaggacggcgtggatccggtcgaggccgctgccgcggtg
gccggcgaatcgtccaccgccacctggacggtggtgtggaccgaccgcctgaccgcctgc
gacatgtaccgcgccaaggcctaccgggtcgacccggtgcccaacaacccggaacagttc
ttctgctacgtggcctatgacctgtcgctgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggccgcgcgcctggaagac
atgcgctttccggtggcctatgtgaagaccttcgccggcccgtccacgggcatcatcgtc
gagcgcgagcgcctggacaagttcggccgcccgctgctgggcgccaccaccaagcccaag
ctgggcctgtcgggccgcaactatggccgcgtggtgtacgagggcctgaagggcgggctg
gacttcatgaaggatgacgagaacatcaactcgcagcccttcatgcactggcgcgaccgc
ttcctgttcgtgatggacgcggtcaacaaggcttctgccgccaccggcgaggtcaagggc
agctacctcaacgtgaccgccggcaccatggaagagatgtaccggcgcgccgagttcgcc
aagtcgctgggctcggtcatcatcatgatcgacctgatcgtcggctggacctgcatccag
tcgatgagcaactggtgccgccagaacgacatgatcctgcacctgcaccgcgcgggccat
ggcacctacacccggcagaagaaccacggcgtgtcgttccgcgtgattgccaagtggctg
cgcctggccggcgtggaccacatgcacaccggcaccgcggtgggcaagctggaaggcgat
ccgctgaccgtgcagggctactacaacgtctgccgcgacgcctacacccataccgacctg
acccgcgggctgttcttcgaccaggactgggcctcgctgcgcaaggtgatgccggtggcc
tcgggcggcattcatgcaggccagatgcaccagctgatccacctctttggcgacgacgtg
gtgctgcagttcggcggcggcacgatcggccacccgcagggcatccaggcaggcgccacc
gccaaccgcgtcgcgctggaagcgatggtgctggcgcgcaacgaaggccgcgacatcctc
aatgaagggccggagatcctgcgcgacgccgcgcgctggtgcgggccgctgcgggccgcg
ctcgatacctggggcgacatcagcttcaactacacgccgaccgacacctcggacttcgtg
cccaccgcatcggtggcctga

DBGET integrated database retrieval system