KEGG   Cupriavidus necator NH9: BJN34_32180Help
Entry
BJN34_32180       CDS       T05121                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00020  Citrate cycle (TCA cycle)
cuh00480  Glutathione metabolism
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01120  Microbial metabolism in diverse environments
cuh01130  Biosynthesis of antibiotics
cuh01200  Carbon metabolism
cuh01210  2-Oxocarboxylic acid metabolism
cuh01230  Biosynthesis of amino acids
Module
cuh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cuh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJN34_32180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJN34_32180
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BJN34_32180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: AQV98536
UniProt: A0A1U9V0P5
LinkDB All DBs
Position
2:complement(2696532..2698769)
Genome map
AA seq 745 aa AA seqDB search
MSNQQPTIIYTLTDEAPLLATSAFLPIIQTFTKPAGINVTTSDISVAGRILGEFPEFLTE
AQRVPDNLAELGKLTQQPDTNIIKLPNISASVHQLVSAVRELQGKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNFARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELVTKSGKTIVLKPKVALLDGEIIDSMFMSKKALCDFYEE
QFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGALFDELGVNVNNGLV
NLYEKIEALPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDLATGEVLLTQDVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDYDTKGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDVGIKTGNARAKILAKTLDAATGKLLDNNKSPSPKTGQLDNR
GSQFYLAMYWAQELAAQSDDAELAAKFAQLARTLTDNEQKIVGELGAVQGQPVDIGGYYQ
PDAAKLSAAMRPSQTLNAALASVAA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccagcaacccaccatcatctacacgctgaccgacgaagctccgctgctggcg
accagtgcgttcctcccgatcatccagaccttcaccaagccggccggcatcaacgtgacc
accagcgacatctcggtggcgggccgtatcctgggtgaattccccgaattcctgaccgaa
gcacagcgcgtgccggacaacctggccgagctgggcaagctgacgcagcagccggacacc
aacatcatcaagctgcccaatatctccgcctcggtgcaccagctggtcagcgccgtccgc
gagctgcagggcaagggctacaaggtgccggactatccggaagacccgaagaccgacgaa
gaaaaggccatccagaagcgctattccaagtgcctgggcagcgccgtgaacccggtcctg
cgcgaaggcaactccgaccgccgcgcccccgccgcggtcaagaactttgcgcgcaagcac
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtggcccacatgaagcat
ggcgacttctaccacggcgaaaagtcgatgacgctggaccgcgcccgcgacgtcaagatg
gagctggtcaccaagagcggcaagaccatcgtgctcaagcccaaggttgcgctgctggac
ggcgagatcatcgacagcatgttcatgagcaagaaggcgctgtgcgacttctatgaagag
cagttcgaagacgcgcgcaagaccggcgtgatgctgtcgctgcacgtcaaggccaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagatcttctacaaggaagcc
tttgccaagcacggcgcgctgttcgatgaactgggcgtgaatgtcaacaacggcctggtc
aacctgtacgaaaagatcgaggcgctgcccagctccaagcgcgaagagatcatccgcgac
ctgcacgcctgccacgagcatcgcccggaactggccatggtggattcggccaagggcatc
tccaacctgcacgcgcccaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggccgtgatcccg
gaaagcacctttgcccgcatctaccaggagatcatcaacttctgcaagaccaacggcaat
ttcgacccgaccaccatgggcaccgtgcccaatgtgggcctgatggcgcagaaggctgaa
gagtacggctcgcacgacaagaccttcgagatcgccgaagacggcgtcgccaacatcgtc
gacctggccaccggtgaagtgctgctgacgcaggacgtcgagcagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggccgtcacgcgcgcg
cgcaattcgggcatgccggcggtgttctggctggacccgtaccgtccgcacgaagccgag
ctgatcaagaaggtcgagacctacctgaaggactacgacaccaagggcctggacatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctcgagcgcgtgatccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgcccctgatggcaggtggcggcatg
tatgagaccggcgccggcggttcggcgccgaagcacgtcaagcagctggtggaagaaaac
cacctgcgctgggattcgctgggcgagttcctggcgctggccgtgtcgctggaagatgtc
ggcatcaagaccggcaatgcccgcgccaagatcctggccaagacgctggacgcggccacc
ggcaagctgctcgacaacaacaagagcccgtcgcccaagaccggccagctggacaaccgc
ggcagccagttctacctggcgatgtactgggcgcaggaactggcggcccagtcggacgac
gcggaactggccgcgaagttcgcgcagctggccaggacgctgaccgacaacgagcagaag
atcgttggcgaactgggcgccgtgcaaggccagccggtggatatcggcggctactaccag
ccggacgccgccaagctcagcgccgcaatgcgcccgagccagacgctgaatgccgcgctg
gcatcggtggcagcctga

DBGET integrated database retrieval system