KEGG   Cupriavidus necator NH9: BJN34_32360Help
Entry
BJN34_32360       CDS       T05121                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00010  Glycolysis / Gluconeogenesis
cuh00620  Pyruvate metabolism
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJN34_32360
   00620 Pyruvate metabolism
    BJN34_32360
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BJN34_32360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AQV98572
UniProt: A0A1U9V0W4
LinkDB All DBs
Position
2:2741593..2743113
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVSNPYKQQYENYIGGAWVPPAGGEYFESITPITGKPFTRVPRSGQQDVDA
ALDAAHAAKAAWARTSTTERANILNRIADRIEANLKLLAVAESIDNGKPVRETTAADLPL
AVDHFRYFAGCIRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEVIGDLLPPGVINVINGFGLEAGKPLASSPRISKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDTGTMIGAQASAEQLEKILSYIDLGR
KEGAQCLAGGERNVLDGDLAGGYYVKPTVFAGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcggaaatcgcccagctgggcgtcagcaacccctacaagcagcagtacgag
aactacatcggcggcgcctgggtgccgccggccggcggcgagtacttcgaatcgatcacg
ccgatcactggcaagccgttcacgcgcgtgccgcgctccggccagcaggatgtcgacgct
gcgctggacgccgcgcacgccgccaaggccgcatgggcgcgcacctcgaccaccgagcgc
gccaatatcctgaaccgcatcgccgaccgcatcgaagccaacctgaagctgctggccgtg
gccgagagcatcgacaacggcaagccggtgcgcgaaaccaccgccgccgacctgccgctg
gcggtcgaccacttccgctactttgccggctgcatccgtgcgcaggaaggcggcatctcc
gagatcgacgctgacaccatcgcctatcacttccatgaaccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggccccggcgctggcc
gccggcaactgcgtggtgctcaagcccgccgaacaaacgcccgcttcgatcctggtgctg
atggaagtgatcggcgacctgctgccgccgggcgtgatcaacgtcatcaacggcttcggc
ctggaagccggcaagccgctggcatcgagcccgcgcatcagcaaggtggccttcaccggc
gagaccaccaccggccgcctgatcatgcagtacgcctcgcagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaacatcttcttcgaagacgtgctggccgccgacgac
gccttcttcgacaaggcgctggaaggctttgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctatgaccgcttcatggaacgc
gcgctcaagcgcgtggccgcgatccgccagggccatccgctcgacaccggcaccatgatc
ggcgcgcaggcgtcggccgaacagctggagaagatcctgtcgtacatcgacctgggccgc
aaggaaggtgcgcagtgcctcgccggcggcgagcgcaacgtgctcgacggcgacctggcg
ggcggctactacgtcaagccgaccgtattcgccggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtggtatcggtgaccaccttcaaggatgaagaagaggcactg
gccatcgccaacgacacgctctacgggctcggcgccggcgtctggacacgggacggcgcg
cgcgccttccgcatgggccgcggcatccaggcggggcgcgtgtggaccaactgctaccac
gcctaccccgcgcatgccgcattcgggggatacaagcagtccggcatcggccgcgagaac
catcgcatgatgctcgaccactaccagcagaccaagaacctgctggtgagctacagtccc
aacgcactcgggttcttctga

DBGET integrated database retrieval system