KEGG   Cupriavidus necator NH9: BJN34_34490Help
Entry
BJN34_34490       CDS       T05121                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00250  Alanine, aspartate and glutamate metabolism
cuh00410  beta-Alanine metabolism
cuh00640  Propanoate metabolism
cuh00650  Butanoate metabolism
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
Module
cuh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJN34_34490
   00650 Butanoate metabolism
    BJN34_34490
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJN34_34490
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJN34_34490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cuh01007]
    BJN34_34490
Enzymes [BR:cuh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BJN34_34490
Amino acid related enzymes [BR:cuh01007]
 Aminotransferase (transaminase)
  Class III
   BJN34_34490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQV98990
UniProt: A0A1U9V221
LinkDB All DBs
Position
2:complement(3235885..3237168)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAERAENAELWDVEGRRFIDFAAGIAVVNTGHRHPR
LVKAVADQLDRFTHTAYQIVPYASYVELAEKINARAPGDFAKKTAFFTTGAEAVENAIKI
ARAFTGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLGFGPFPGEVFHAPYPNPLHGVTTA
ESLRAVEALFKTDIDPKRVAAMIFEPVQGEGGFYAAPADFVRGLRKLCNEHGILLIADEV
QTGFARTGKLFAMQHHDVVPDLTTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEEALCERATMLGDKLKAKLIALQDDIPQIADVRGPGAMVALEFCK
AGTNEPDAEMTKRVQARALERGLLLLVCGVYANVIRFLFPLTIPDAVFDEAIGILDEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgctgatctgcaagcgcgcaagaacgccgctaccccgcgcggcgttggcgtc
atgtgcgatttctacgccgagcgcgcggagaacgctgaactgtgggatgtcgagggccgc
cgtttcatcgatttcgcagcaggtatcgcggtggtgaacacgggccatcgccatcccagg
ctggtgaaggcggtggccgaccagctggaccgcttcacccataccgcctaccagatcgtg
ccctatgcctcttacgtggaactggccgaaaagatcaatgcgcgcgcgccgggcgacttc
gcgaagaagaccgccttcttcacgactggcgcggaggctgtcgagaacgccatcaagatc
gcccgcgcattcaccggccggccgggcgtgattgccttctccggcggctttcatggccgt
acgatgatgggcatggcgctgaccggcaaggtggcgccgtacaagcttggcttcggcccg
tttccgggcgaagtgttccacgcgccgtacccgaatccgctgcacggcgtgacgacggcc
gaatcgctgcgcgcggtcgaggcgctcttcaagaccgacatcgatccgaagcgcgtcgcc
gcgatgattttcgagccggtgcagggcgaaggcggcttctacgcggcgcctgccgatttc
gtgcgcgggctgcgcaagctgtgcaacgagcacggcattctgctgattgccgacgaagtg
cagaccggctttgcgcgtaccggcaagctgtttgcgatgcagcaccatgacgtggtgccc
gacctgaccacgatggcgaagagcctggcaggcggcatgccgttgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggcggcgcccggcggcctgggcggcacgtatgccggcaat
ccgctcgccgtggcggcggcgcacgcggtgctggacatcattgacgaggaggcgctgtgc
gaacgcgcaaccatgctcggcgacaagctcaaggcgaagctcatcgcgctgcaggatgac
ataccccagatcgccgatgtgcgcggccctggcgcgatggtcgccttggagttctgcaag
gcgggcacgaacgagccggatgccgaaatgacgaagcgcgtgcaggcgcgcgcgctggag
cgcggcctgttgctgctggtgtgcggcgtgtacgcgaacgtcattcgcttcctgtttccg
ctgacgattcccgacgccgtgttcgacgaagccatcggcattctggatgaggtgctgaag
gaaacggtgggcgtgccagcctga

DBGET integrated database retrieval system