KEGG   Cupriavidus sp. NH9: BJN34_34860Help
Entry
BJN34_34860       CDS       T05121                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cuh  Cupriavidus sp. NH9
Pathway
cuh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJN34_34860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cuh02000]
    BJN34_34860
Enzymes [BR:cuh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJN34_34860
Transporters [BR:cuh02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJN34_34860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C Glutaredoxin GST_C_3 DUF5449
Motif
Other DBs
NCBI-ProteinID: AQV99061
UniProt: A0A1U9V3I7
LinkDB All DBs
Position
2:complement(3322866..3323519)
Genome map
AA seq 217 aa AA seqDB search
MELYAHPFSSYCQKVLVALYENAIPFEFRMLSPEHAQNMDELARRWPLRRMPVLVDDGRS
VFESSIIVEYLDQHHRGPVRWLPESSDAALQVRLLDRFFDQYVMTPMQRIVADYLRLAEH
RDAFGVAEARKLLDSAYAWLESTLAGREWAAGGAFTLADCAAAPSLFYADWVQPIPDACG
NVRAYRNRLLARPSFARAVDEARPYRPLFPPGAPDRD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggagctatacgcccacccgttttcgtcctattgccagaaggtcctcgttgcgttgtac
gagaacgccatccctttcgagttccgcatgctgtcgcccgagcacgcgcagaacatggat
gaactcgccaggcggtggccgctcaggcgcatgccggtgctggtcgacgacggccgctcg
gtgttcgagtccagcatcatcgtcgaatacctggaccagcatcaccgcggtcccgtgcgc
tggctgccggagtcgtccgacgcggcgctgcaggtgcgcctgctcgaccgtttcttcgac
cagtacgtgatgacgccgatgcaacgcatcgtggccgactacctgcgcctggcggagcac
cgcgatgcctttggcgtggccgaggcgcgcaagctgctcgattcggcctatgcctggctg
gagtcaacgctggccggccgggaatgggctgcaggcggcgcctttacactggctgactgc
gccgctgccccgtcgctgttctatgcggactgggtgcagccgatcccggatgcgtgcggc
aacgtgcgcgcctatcgcaaccggctgctggcgcggccgtcgtttgcccgcgcggtggac
gaggcacggccctatcgcccgctcttcccgccgggtgcgccggaccgggactga

DBGET integrated database retrieval system