KEGG   Cronobacter universalis: AFK65_00585Help
Entry
AFK65_00585       CDS       T04063                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cui  Cronobacter universalis
Brite
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFK65_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALB56839
UniProt: A0A376DWK9
LinkDB All DBs
Position
128241..128861
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPELANLPVEELITK
LDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVEKFKEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGYPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFASQK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttacacactgccatccctgccgtacgcatacgacgccctggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacctacgtcaacaacgctaac
gcggcgctggaaagcctgccggaactggcgaatctgccggttgaagaactgatcaccaaa
ctggatcaggttccggctgataaaaaaaccgttctgcgtaacaacgcgggcggccacgcg
aaccacagcctgttctggaaaggcctgaaaaaaggcaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggctccgttgagaaattcaaagaagagttcgagaaagcg
gctgcgacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaaactggct
gtcgtttccaccgcaaaccaggattccccgctgatgggcgaagctatctccggcgcttcc
ggctacccgatcctgggcctggacgtgtgggagcacgcgtactacctgaaattccagaac
cgtcgtccggactacatcaaagagttctggaacgtggttaactgggacgaagccgcagcg
cgtttcgcttctcagaaataa

DBGET integrated database retrieval system