KEGG   Cronobacter universalis: AFK65_02310
Entry
AFK65_02310       CDS       T04063                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cui  Cronobacter universalis
Pathway
cui00052  Galactose metabolism
cui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFK65_02310
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AFK65_02310
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Methyltransf_25 Peptidase_U32 UDPG_MGDP_dh_N MTS TrkA_N Methyltransf_31 3HCDH_N Pyr_redox_2 Met_10 Shikimate_DH ELFV_dehydrog XdhC_C Pyr_redox CoA_binding PrmA
Other DBs
NCBI-ProteinID: ALB53548
UniProt: A0A376E0Z0
LinkDB
Position
complement(492704..493747)
AA seq 347 aa
MKSVVIHAEGSVRVEERPVPTVEADDEVLVKVVCSGLCGSDIPRIFARGAHYYPITLGHE
FSGYVERCGSAVSDLSPGDAVACVPLRPCFACEACARGYFSLCRHYQFVGSRSEGGHAEY
IVVRRASLFLLPPEMPVEDGAFLEPVTVGLHAFHLAQGCEGKNVVIVGAGTIGLLAMQCA
QALGANSVTAIDINPEKLRLAHTLGADRVLNSRELSAQAIREMLEPQRFDQLVLETAGAP
QTVSLAIDIAGPRAQVALVGTLHHDLTLSAAVFGKILRNELTLLGSWMNYSSSWPGDEWR
TAARLLAEKRLSLRPLIAHQGDAESFVSAVQALNGAPMQGKILLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcatgctgagggcagcgtgcgcgttgaagaacgccctgtgccc
actgtcgaggcggacgacgaggtgctggtaaaagtcgtttgctcgggtttatgcggctca
gatatcccccgcattttcgcccgcggcgcgcactactatcccatcacgctgggccatgag
tttagcggttatgtggagcgctgcggcagcgcggtgagcgatctttcgcccggcgatgcg
gtggcctgcgttccgctacggccctgttttgcatgtgaagcgtgcgcgcgcggttacttt
tccctgtgtcggcactaccagtttgtcggctcccgcagcgagggcggccacgccgagtac
attgtggtcaggcgcgccagcctctttcttttgccgccggagatgccggttgaagatggc
gcgtttcttgagcctgtcaccgtcgggctgcacgcctttcacctggctcagggatgcgaa
ggcaaaaacgtggtgattgtcggcgctggcactattggtctgctggcgatgcagtgcgcg
caggcgctgggcgcgaacagtgtgacggccattgatattaacccggaaaagctccgactg
gcgcacacgctcggcgccgatcgcgtgctgaacagccgggagctatccgcgcaggccatt
cgcgaaatgctggagccgcagcgcttcgaccagctggtgctggaaaccgcgggcgctccg
cagacggtatcactggcgatagacatcgccgggccgcgcgcgcaggtcgcgctggtgggg
acgctgcaccatgaccttaccctctccgccgcggtttttggcaaaattttgcgtaatgaa
ctgacgctgctcggcagctggatgaactattcgtcgtcctggccgggcgatgagtggcga
accgccgcgcgactgcttgccgaaaaacggctgtcgctcaggccgctgattgcgcatcag
ggggatgcggaaagcttcgtgagcgccgtccaggcgctcaacggcgcgccgatgcagggc
aagattctgctgcgcttcgcctga

DBGET integrated database retrieval system