KEGG   Cronobacter universalis: AFK65_04740Help
Entry
AFK65_04740       CDS       T04063                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cui  Cronobacter universalis
Pathway
cui00473  D-Alanine metabolism
cui00550  Peptidoglycan biosynthesis
cui01100  Metabolic pathways
cui01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFK65_04740
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK65_04740
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AFK65_04740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cui01011]
    AFK65_04740
Enzymes [BR:cui01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFK65_04740
Peptidoglycan biosynthesis and degradation proteins [BR:cui01011]
 Precursor biosynthesis
  Amino acid ligase
   AFK65_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ALB54003
UniProt: K8DQ20
LinkDB All DBs
Position
complement(1044559..1045659)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKEKFDVVLLGIDKQGQWHVNDASRYLLN
AEDPARIALHRSEKNVALIPGLSQQQLIESDNRQALPQLDVIFPIVHGTLGEDGSLQGML
RMANIPFVGSGVLGSAVSMDKDVAKRLLRDAGLAVAPFITLTRASRQRISFEDVKAQLGL
PLFVKPANQGSSVGVSKVNDEAQYHAAVALAFEFDHKVVVETGIKGREIECAVLGNEEPQ
ASTCGEIVVSSEFYSYDTKYIDDQAARVVVPADIAPDVNEKIRAIAVRAFQALECAGLAR
VDVFLTPDNEVIINEINTLPGFTNISMYPKLWQASGIGYQELITRLIELALERHQADASL
KSSITG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgcgtgggcattgtgtttggcggaaaatcggcggagcacgaggtgtcg
cttcagtcggcgaaaaatatcgtcgatgcgattgataaagaaaaattcgacgtcgtgctg
ctgggcattgataaacagggccagtggcatgtgaatgacgcctcccgctatctgctgaac
gcggaagatccggcgcgcatcgccctgcaccgttccgaaaaaaatgtcgcgctgatcccg
ggcctcagccagcagcaactcatcgaatcggacaaccgccaggcgctgccgcagctggat
gtgatcttcccgattgtccacggcacgctcggcgaagacggctccctgcaggggatgctg
cgtatggcgaatattccgtttgtcggctccggcgtgctcggctcggcggtcagcatggat
aaagacgtcgccaaacgtctgctgcgcgacgccggtcttgcggtcgcgccctttattacg
cttacccgcgccagccgccagcgcatctcttttgaagacgtgaaagcgcagctcggcctg
ccgctgtttgtgaagcccgcgaaccagggctcttccgtcggcgtcagcaaagtgaatgac
gaagcgcagtatcacgccgccgtcgcgctggcgtttgagttcgaccataaagtggtggtg
gaaaccggcattaaaggccgtgagatcgagtgcgcggtgctcggcaacgaggaaccgcag
gcgagcacctgtggggagatcgtggtgagcagcgagttttactcctacgacaccaaatac
atcgacgatcaggccgcccgcgtggtggtgcctgcggatatcgcgcctgacgtgaatgag
aagatccgcgctatcgcggttcgtgcgtttcaggcgctggagtgcgcggggcttgcgcgc
gttgacgtgttcctgacaccggacaacgaggtgatcattaatgagatcaatacgctgccg
ggctttaccaatatcagcatgtatccgaagctgtggcaggcgagcggcattggctaccag
gaattgatcacccgcctgattgaactggcgctggagcgccaccaggccgatgcgtcgctg
aaaagctcgatcaccggctaa

DBGET integrated database retrieval system