KEGG   Cronobacter universalis: AFK65_05655Help
Entry
AFK65_05655       CDS       T04063                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cui  Cronobacter universalis
Brite
KEGG Orthology (KO) [BR:cui00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFK65_05655
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AFK65_05655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALB54170
UniProt: A0A376E6Z4
LinkDB All DBs
Position
1244124..1245689
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAA
RKPSFLITNPGSMQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGAVFQNEITDRNIMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKSHVDDYDVDVIDTQSATKLIPAASEG
GLHQIETASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAMTTEVKGD
GTKLTGLDYQDRVTGSVKHLEVAGIFVQIGLLPNTTWLDGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacccagctcaaggcctatcttgagcgtctgacaaaacct
gttgagttagtggccacgctggatgacagcgcgaaatcggcagagatcaaagaactgctg
ctggaaatcgccgagctgtccgacaaagtctccttccgggaagacaacacgctggcggcg
cgcaaaccttcatttttgattaccaacccgggttccatgcagggtccgcgctttgcaggc
tctccgctgggtcacgaatttacgtcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggctctgctggagcagatccgcgacctggacggcgatttcgag
tttgaaacctactactcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcagtcctgaacccgcgcattaaacacacggcgattgatggcgcggtgttccag
aatgaaatcaccgatcgcaacatcatgggcgtgccggccgtgttcatgaacggcgtggag
ttcggctctggccgtatgacgcttgcggaaatcgtcgcgaaagtggataccggcgctgaa
aaacgcgcggcggaagagctgaaccagcgcgacgcttacgacgtgctgattgtcggctcc
ggcccggcgggcgcggcggcggcgatttactccgcacgtaaaggcattcgtaccggcctg
atgggcgagcgtttcggcggccaggtgctggacaccgtagacatcgaaaactacatctct
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaagtcgcatgtggatgattac
gacgttgacgttatcgacacccagagcgcgacgaagctgattccggcggcgagcgaaggc
ggcctgcaccagattgaaacggcgtccggcgcggtgctgaaagcgcgcagcgtgatcgtg
gcgaccggcgcgaaatggcgcaacatgggcgtgcctggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtcgcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctcgcggggatcgttgagcac
gtaacgctgctggaatttgcgccggagatgaaagccgaccaggtgttgcaggataaactg
cgcagcctgaaaaacgtcgacatcattctgaatgcgatgaccaccgaagtgaaaggcgac
ggcacgaaactgaccggccttgattatcaggatcgcgtaacgggctctgtgaagcatctg
gaagtggcggggatctttgtgcagattggtctgctgcctaataccacctggcttgacggc
gctatcgagcgtaaccgcatgggcgagatcatcatcgacgccaaatgcgagaccagcgtg
aagggcgtattcgccgcgggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
accggcgagggcgcgaaagcctccctgagcgcgtttgattatctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system