KEGG   Cronobacter universalis: AFK65_09025Help
Entry
AFK65_09025       CDS       T04063                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cui  Cronobacter universalis
Pathway
cui00480  Glutathione metabolism
cui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK65_09025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cui02000]
    AFK65_09025
Enzymes [BR:cui01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFK65_09025
Transporters [BR:cui02000]
 Other transporters
  Pores ion channels [TC:1]
   AFK65_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALB54796
UniProt: A0A376EC37
LinkDB All DBs
Position
complement(1972047..1972655)
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREADIDFTLVAVDLAAKRTENGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YQARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gccgatatcgattttacgctggtggcggtagatctggccgcaaagcgcacggagaacggc
gaagactacctgaccattaacccgaagggtcaggtgccggcgctgctgctggatgataat
acgctgctgacagagggcgtcgctattgtgcagtacatcgcagatcttgtgccggaccgt
cagttgctcgcccctgtcggcagcatgacccgttaccacacgctggagtggctgaactat
atcgccaccgagctgcataaaggttttacgccgctgttccgcccggatacgccggatgag
tataagaccatcgcgcgcgcgcagttgcagaagaaattcgcgtatgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcttacctgtttacc
gtgctgaactgggcgaaagcggtcggacttgagatgcaggcgtttgacaatatcgccgac
taccaggctcgcgtgaaagcgcgtcctgccgtcgcggcggcgctgaaggcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system