KEGG   Cronobacter universalis: AFK65_10970Help
Entry
AFK65_10970       CDS       T04063                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cui  Cronobacter universalis
Pathway
cui00061  Fatty acid biosynthesis
cui00780  Biotin metabolism
cui01100  Metabolic pathways
cui01130  Biosynthesis of antibiotics
cui01212  Fatty acid metabolism
Module
cui_M00083  Fatty acid biosynthesis, elongation
cui_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AFK65_10970
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AFK65_10970
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AFK65_10970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cui01004]
    AFK65_10970
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AFK65_10970
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AFK65_10970
Lipid biosynthesis proteins [BR:cui01004]
 Fatty acid synthase
  Component type
   AFK65_10970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ALB55161
UniProt: A0A376EIT4
LinkDB All DBs
Position
2368308..2369096
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLDSSIV
LPCDVAEDESIDALFTELAKVWPKFDGFVHSIGFAPADQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKACRSMLNPNAALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSGGI
TGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaccggtaagcgcattctggtgactggcgtagccagcaaactgtccatc
gcgtacggtatcgcacaggcaatgcaccgtgaaggggctgaactggcgttcacctaccag
aacgacaagctgaaaggccgcgtggaagagtttgccgctcaactggactccagcatcgtg
ctgccgtgtgacgttgcggaagatgaaagcatcgacgcgctgttcaccgagcttgccaaa
gtctggccgaaatttgacggtttcgtacactccatcggtttcgcgccggccgatcagctg
gacggcgactacgttaacgccgtgacccgtgaaggcttcaaaatcgcgcacgacatcagc
gcatacagctttgtggcaatggcgaaagcgtgccgttctatgctgaacccgaacgcggcg
ctgctgaccctctcctacctgggcgcagagcgtgctatcccgaactacaacgtgatgggt
ctggcgaaagcgtctctggaagccaacgtacgctacatggcgaacgcgatgggtccggaa
ggcgtgcgcgttaacgccatctccgcaggcccgatccgcacgctggcggcttccggcatt
aaagatttccgtaagatgctggcgcactgcgaagcggtcaccccgatccgccgcaccgtc
accatcgaagacgtgggtaactccgcggcgttcctgtgttccgatctctccggcggtatc
accggcgaagtggttcacgttgacggcggtttcagcatcgctgcgatgaatgagctggaa
ctgaaataa

DBGET integrated database retrieval system