KEGG   Corynebacterium ulcerans 131002: CUL131002_0049cHelp
Entry
CUL131002_0049c   CDS       T03899                                 

Gene name
pknA
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cuj  Corynebacterium ulcerans 131002
Brite
KEGG Orthology (KO) [BR:cuj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cuj01001]
    CUL131002_0049c (pknA)
Enzymes [BR:cuj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CUL131002_0049c (pknA)
Protein kinases [BR:cuj01001]
 Serine/threonine kinases: Other
  Bacterial family
   CUL131002_0049c (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AKA95610
UniProt: A0A0E3H5C9
LinkDB All DBs
Position
complement(45522..47066)
Genome map
AA seq 514 aa AA seqDB search
MVRRDRTNMSTDYNSPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQREVAVKVLR
PEFSDNNEFLSRFRNEALASENILSENVVQTFDYRELTDPSGRTLCFIVMEYVRGESLAD
MLARKGSLDEHLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKITDFGIAKA
AAAVPLTRTGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGARPFTGDSSVSV
AIAHINQAPPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSATRMGQRPPQPQS
AQLQQIAPEPTPTASTHALGQTAQPTTVIPATGEVPQTVAAGQVAGPRTGYNAAPATIPP
EENKKSSSGVGTGLAVGVLLAALFGAGIWAASQGLFGDVMGGSDQPSSSVNPETITATVT
ETPTIREEPRPIQRPQETPTPTSEPSEFPDASESVVPLPSTDNPRTAPTVDLNEGSQIPS
THRNPAPTPTRGNGSDPITDLLNSFNAPEQGGAP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgcagagataggacgaacatgagcacagattacaattctccagatcccgcgctc
caggccctcatcggcgacgattatcgtctccagtgggttgtgggtaccggcggcatgtct
acggtatggcttgccgacgacacccgtaaccagcgcgaggtggctgtcaaagttctgcgc
cccgagttttctgacaacaacgagttcctctcccgcttccgtaatgaggcgctagccagc
gagaacatcctctcagaaaacgttgtacaaacttttgattaccgcgaactcaccgaccct
tctggccggacgctgtgcttcatcgtcatggagtatgtgcgtggtgaatccctcgcagac
atgctggcgcgcaaaggcagcctcgacgagcaccttgccctcgatgtccttgaacaggca
gctcatggcttgtccatcatccataggatgggcatggttcaccgagacattaagcccggt
aacctcctgatcactcaaaatggccaagtaaaaatcaccgattttggtatagctaaagcc
gctgcggctgtcccactgacccgcaccggcatggtcgtgggaactgcacagtacgtctca
cctgaacaagcccaaggcaaagacgtcaccgaagcttctgatgtgtattccctgggtgtt
gttgggtatgagatgctcgctggtgcgcgtcctttcactggtgattcttctgtctcagtg
gctatcgcccacatcaatcaggcgccgccggctctgcccactacggtttcagccccggcg
cgcgaactcatcggtatcgctttgcgtaaagacccagcgcaccgatatgccgatggcaat
gagcttgcactggcagtatccgcaacccgcatggggcaacggccgccacaaccacagtca
gcacagcttcagcagatagcacccgagcccacgcctaccgcgtcaacgcacgcgttaggt
caaacggcacagcccaccactgtcatcccagcgaccggggaggttccacagactgttgcc
gccggccaggtagcggggccgcgcactggttataatgcggctccagccacgatcccaccg
gaagaaaataaaaagagttccagcggggtgggcactggccttgctgtgggggttctcctc
gcagcattgtttggagccggaatatgggctgctagccagggtctttttggtgatgtgatg
ggcggaagcgaccaacccagtagttcagttaaccctgagacgattaccgcaacggtaacg
gaaacgcctacgattcgggaagaaccgcggccaatccagcgcccacaggagactcctacg
ccgaccagcgagccatcggagtttcctgatgcctcggagtctgttgttccgcttccgtct
acggataaccctcggacggcgccgactgtagacctcaacgagggatcccaaattccttct
actcatcgcaatccggctcccactccaacgcgcggaaacggttccgaccccatcaccgat
ctactgaacagttttaatgccccagaacaaggaggtgccccatga

DBGET integrated database retrieval system