KEGG   Corynebacterium ulcerans 131002: CUL131002_1199cHelp
Entry
CUL131002_1199c   CDS       T03899                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPC) (PEPCase)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cuj  Corynebacterium ulcerans 131002
Pathway
cuj00620  Pyruvate metabolism
cuj00680  Methane metabolism
cuj01100  Metabolic pathways
cuj01120  Microbial metabolism in diverse environments
cuj01200  Carbon metabolism
Module
cuj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cuj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUL131002_1199c (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CUL131002_1199c (ppc)
Enzymes [BR:cuj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CUL131002_1199c (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA96729
UniProt: A0A0E3KTT1
LinkDB All DBs
Position
complement(1279354..1282191)
Genome map
AA seq 945 aa AA seqDB search
MRSLSFMPVKAMSAGPLSEQLVEDIRFLGALLGEVIKEQEGTAAFDRVEAARQLAFKISR
KEAQVEDLVSLLKDISAADAISIIRAFSHFALLANMVEDLHDELGRLRRQEAGEEDPDST
LGATWKKLAKAGVTSEDVSGLLRNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKERHAI
LSADPNALTATRLEENTRRIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYKLSLLAAIP
EINKQVADHIQREYGVSSDDALRSLLIKPGSWIGGDHDGNPYVTAETLHYATTRAAETVL
KFYVRELHQLEHELSLSDRLTDVSTALRALADLGHNDVPSRVDEPYRRAVHGVRGRVLAT
LASRIGTEAVEGSWYARHDAYSDPDELAADLDVIDASLRRTHDELIADDRLLRIRTAVSS
FGFHLYSMDLRQNSESYEDVLTELFERAHVTKHYCELDENEKIRVLTAELSSPRPLIPRD
GAPYSEVTQRELDIIAEAKRAVDAFGPMMIPHSIISMAESASDILEPMILLKEFGLIRVQ
GGQLTGHIDVIPLFETIDDLQNGAKILQDLWQIPLYCRYLEQRNNLQEVMLGYSDSNKDG
GYLAANWALYAAETDLVSVCKQHGVSLRLFHGRGGTVGRGGGPSYDAILAQPHGAVQGSV
RVTEQGEIISAKYGSVGAARRNLEALASATLEASLLTIDQVEEQYPEAYEIMSEISRLSQ
RKYSRLAHEDPGFIEYFTSSTPLEEIGDLNIGSRPSSRKQTKSIDDLRAIPWVLSWSQSR
VMLPGWYGVGSALHEWVEKGCVRTAELSADERLAILQKLNDSWPFFSSVLSNMAQVMSKA
EMQLAKLYSGLVADQEAANRIFADISAEFDLTKTMFLKITGFSGLLDDNPMLARSVRSRY
PYLLPLNTLQLEMLRRYREGDTDPKVVHGIRLAMNGLATALRNSG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
gtgaggagcttaagcttcatgcctgtaaaagctatgtctgcaggtccactatccgaacag
cttgttgaggatatacgctttctaggtgcacttttgggggaggtgatcaaagagcaagag
ggaacggcagcctttgaccgagtcgaagcagcgcgacagctggcttttaaaatctcgcgc
aaagaggcacaggttgaagacttagtatcactgctcaaagatatttcagcagcagacgct
atatcgattattagagcgtttagccattttgcgctgctagcaaacatggtggaggacttg
cacgatgaactgggtagactccgacgacaagaagccggtgaagaagacccagattcaact
ttgggtgcgacctggaaaaagcttgctaaggctggagtaacgagcgaagacgtgtccggt
ttactccgtaactttcaagttgccccggtgcttaccgctcaccctacggaaacccgtaga
cgtacgatttttgatgcgcaagagcatatgactactttgctcaaagaacgtcatgcgatt
ctgagcgcagatccgaatgcgctgacggctacgcgtcttgaagagaatactcgtcggatt
cgccggtggctgactctcatatggcagaccgcgcttatcagagtggcccgacctaggatt
gaggacgaggtagaagttggactgcgatactataagctctccttgcttgctgcgatcccc
gagatcaataaacaagtagctgatcacatccagcgagaatatggcgttagctccgacgac
gctctgcgctccctattaattaaaccgggaagctggatcggcggcgatcatgacggtaac
ccgtatgtcactgcggaaactctgcactatgcgacgacacgagcagcagagactgtatta
aagttttatgtacgcgaattgcaccaacttgagcatgagttatcgctgtcagatcggttg
acggatgtgagcacagccctgcgcgcgcttgccgatttagggcataacgacgttccatcg
cgagtcgatgagccttatcgccgcgctgtccacggtgtgcgtggcagagtacttgctacg
ttggcttctcggattggcacagaagcggtagagggctcgtggtacgcccgtcatgatgct
tattctgatccagatgagcttgcagcagatttggatgtcattgatgcttctctgcggagg
acacacgatgaactcatcgcagatgatcgcttgctgcgcatcaggacagcggtatcaagc
tttggtttccatctctattcgatggatttgcgccaaaattctgagagctatgaggacgtg
cttactgagctgtttgaacgagcccacgtaaccaagcactattgtgaattggacgagaac
gaaaagattcgcgttttgaccgccgaactatcgtcaccgcggcccctcataccgcgcgat
ggcgcgccatatagtgaggtaactcagcgtgagctagacattattgctgaagcaaagcgt
gcagtggatgcctttggcccaatgatgattccgcattcgatcatctcgatggcggaatct
gcgagcgatatcctcgagccgatgatcctactgaaagaattcggattaatccgcgttcag
ggcggtcaactcaccggacacattgacgtcatacctctttttgaaacgatcgatgatctg
caaaatggtgccaagattctccaagatctatggcagataccgctgtactgtcgttatttg
gagcaacgaaacaacctccaagaggtcatgctcggttattccgattccaataaagatggg
ggctatctcgcagcaaactgggcgctgtatgctgcggaaactgatctagtgagcgtgtgt
aaacaacacggtgtatcactgaggcttttccacggccgcggtggaaccgtaggacgcggc
ggaggaccttcttatgacgctatccttgctcagccacatggtgctgtacagggcagtgtg
cgtgtgacggaacaaggcgagatcatttcagcaaaatatggttctgtgggcgcagctcgt
cgtaacctagaagccttggcctcagcaacactggaagcatcgctgctcacaatcgatcaa
gtagaagagcaatatcctgaggcgtatgagatcatgagtgaaatctcacgcttgagtcag
cgaaagtattcgaggcttgctcatgaagatccgggttttattgaatacttcacatcctcc
acacctttggaagagataggtgacctcaacatcggctcgcgtccttcgtcgcgaaaacaa
accaaaagtatcgacgatttacgcgcaattccgtgggtactcagctggtcacagtcccgt
gtcatgcttccaggctggtatggagtaggtagcgctttgcacgagtgggtggaaaaaggc
tgtgtgcgcacagcggaactctcagcagatgagcgccttgctatattgcagaagcttaat
gattcttggccgttcttttcttctgtgctgtctaatatggcgcaggtgatgagcaaagct
gagatgcaacttgcgaagctctattcgggattggtagcagatcaggaagctgcaaacagg
atatttgctgatatttctgccgaattcgatctcactaagacgatgttcctcaagatcacc
ggcttctcggggcttctcgacgacaacccgatgcttgcacgatcagtacgctcgcgctac
ccgtatctgctgccgcttaatacattgcaactcgaaatgttacgtagatatcgcgagggt
gatactgacccgaaggtggtgcatggcattcgcctagctatgaacggcttggctaccgcg
ctgcgaaattctggttag

DBGET integrated database retrieval system