KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00437Help
Entry
CULC22_00437      CDS       T01549                                 

Gene name
nanH
Definition
(GenBank) sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CULC22_00437 (nanH)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CULC22_00437 (nanH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cul02042]
    CULC22_00437 (nanH)
Enzymes [BR:cul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CULC22_00437 (nanH)
Bacterial toxins [BR:cul02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CULC22_00437 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR SOG2
Motif
Other DBs
NCBI-ProteinID: AEG83155
LinkDB All DBs
Position
474924..477038
Genome map
AA seq 704 aa AA seqDB search
MCWLSHFCVFHPSQGRKFPMTESRRRGTRKALITLTAALALTAQGLAVPTTFAEEALSPA
TAPLDNNGLFDAAPPAPVARGAVGEGQLPEPNEKPVFDVKTLRDVDPAGQRCFRIPAIAT
AADGTLLVAFDNRYGPGEQSKTWCRDAPYNNMQHNSQEMQTDIEIYQSSDSGETFETGKF
IAKGTEDPRNLSYTDPAIVVDRETGKIFAFFVRAYDYRLFDANKGINPGPVDAEITRRDV
QDTVVIESDDNGKSWKNMRMLSDLTETLRVKSRPGQEVAGYGRFVTSGSGIQLAYGPKAG
RLLVPIAVNTKDFRQNRVVNLSIYSDDHGLTWQVGEGIAGDGNFGGDENKLVELSDGRIM
MNSKDNDKDRWTSYSLDQGEHWSDPVRTIIAPPQHPEMRNKGINVSLIRAYPNAPEGSAA
ARVLLYSAPIDLRQRSDDGRSNGWVMASCDDGQSWKFGKRIESGRFQYSVMTPMSDGNIG
MVYESATPGAGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEDAKAATAKAEE
ATANVVRLTKELEDLEIDREELLEALDKAKAAAQKAITAAEEANAKVKAAEEATAKAEES
AAKAEDEAKALAEQLAKVEEELAKSQDQAKVLAEAKEAAEIAQKAAEEALRLEKEKNKTG
KDTDNTENKGFWQGLLQVLPGLAPIFSFLASLWDGIQKLFGVKA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtgttggctgtctcatttttgtgtgtttcatccatctcaaggaaggaagtttccaatg
acggagtcacgccgccgtggaactcgcaaagcgctgataactctcacagcagcgcttgct
ctcactgctcaaggccttgcggtccctacaacttttgccgaagaagccctcagccctgca
actgctcccctcgataacaatgggcttttcgacgccgctccgcccgcacctgtagcgcgt
ggcgcagtaggggaggggcaacttcctgaaccaaacgagaagccggtctttgatgtaaag
acgctgcgggacgtggatccagctggtcagcggtgtttccgtattcctgctattgctacg
gctgctgatgggacgcttttggtggcttttgataatcggtatggtccgggcgagcagagt
aaaacctggtgtcgagatgctccatacaataatatgcaacataattctcaggaaatgcag
actgacattgagatttatcaatcctctgactccggtgagacttttgaaaccggcaagttt
attgccaagggaactgaagatcctcggaatctgtcgtataccgatcctgcaatcgttgta
gatcgtgagacagggaagatatttgcgttcttcgtgcgtgcttatgactatcgcttgttt
gatgcaaataagggtataaatccaggtcctgtggatgctgaaattactcgtcgcgatgtt
caagatactgttgttattgagtctgacgataatggtaaatcttggaagaatatgcgtatg
ctcagtgacttaactgagacacttcgtgttaaatctcggccagggcaagaggttgcgggc
tatggaaggtttgtaacttctggtagcggtattcagctggcttatgggcccaaagctggt
cgactgttagttcctattgctgtgaatactaaagattttagacagaatcgagttgtgaat
ctgtctatatactctgacgatcacggtttaacgtggcaagttggggaaggaattgccggc
gacgggaattttggtggcgatgaaaacaagctggttgagttgtctgacgggcgtatcatg
atgaactccaaagacaatgataaagaccgatggacttcgtattcccttgatcaaggggaa
cattggtctgatccagtgcgcactattattgctccgccgcagcatccagaaatgcgaaat
aagggtatcaacgtatcgcttattcgggcctaccctaatgctccagaaggtagtgctgct
gcacgtgtgcttttgtattctgctcccattgatttgcgtcaaagaagtgatgatggtcgg
agcaacggttgggtcatggcatcgtgcgatgatggtcagagttggaagtttggtaaacgg
attgaatcgggccgattccaatattcggtaatgacccctatgtccgacggaaacatcggt
atggtgtacgaatcagctacgcctggagccggcatgaccctcaagttcgccaagttcaac
atggcgtggctgggcgctgattgcttgagtaataaggccctgggtatcactgatctgccg
gatcccgctctggccaaggccattgaagatgcgaaagctgcgacggctaaggctgaggag
gctacagcgaacgtcgtaaggctaacaaaggagctagaggatcttgagattgatagggaa
gaactgctagaagctctggacaaggctaaggcggcagcgcagaaagccattactgctgcg
gaagaggctaatgccaaggttaaggccgctgaggaggctacggcgaaagccgaagaatcc
gctgcaaaggcagaggatgaggctaaagcccttgcagagcaattggccaaggttgaggag
gaattagcaaaatcccaagatcaggcaaaggttctcgctgaggctaaagaggctgccgag
attgctcaaaaagcagcagaagaggcgcttaggttggagaaagagaagaacaaaacaggt
aaagacacagataacaccgaaaataaaggtttttggcaaggtcttttgcaagtcttgcca
ggacttgcacccattttcagtttcttagcatcgctatgggatgggatacagaaattattt
ggggttaaagcctaa

DBGET integrated database retrieval system