KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00510Help
Entry
CULC22_00510      CDS       T01549                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00020  Citrate cycle (TCA cycle)
cul00480  Glutathione metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01130  Biosynthesis of antibiotics
cul01200  Carbon metabolism
cul01210  2-Oxocarboxylic acid metabolism
cul01230  Biosynthesis of amino acids
Module
cul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC22_00510 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CULC22_00510 (icd)
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CULC22_00510 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CAMP_factor
Motif
Other DBs
NCBI-ProteinID: AEG83228
LinkDB All DBs
Position
complement(545201..547411)
Genome map
AA seq 736 aa AA seqDB search
MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGRILSQFPEFLAEDQKV
DDALAELGDLAKTPEANIIKLPNISASVPQLKAAVAELQSQGYKLPDYPDSPSTDEEKDI
RTRYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKHPHRMGAWSADSKTNVVTMESNDFR
HNEKSVIMPSDDTLTIKLVTDNGEKVLKEGLKVLKGEVVDGTFISARALDEFLAVQVKRA
KDEGVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFATYGEQLEAAGLNGENGLAAIYSG
LESLPNGAEIKAAFDAALESGADIAMVNSAKGITNLHVPSDVIIDASMPAMIRTSGHMWN
KNDEEQDTLAVIPDSSYAGVYQTVIADCKKNGAFDPTTMGTVPNVGLMAQKAEEYGSHDK
TFKIEANGTVQVVNSAGEVLIEHNVEAGDIWRACQAKDAPIQDWVKLAVTRSRLSGMPAV
FWLDPERAHDRNLTTLVEKYLADHDTEGLDIRIMSPVDATQFSIDRIRRGEDTISVTGNV
LRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENHLRWDSLG
EFLALAESLRHFANTEGNTKAGVLADALDRATETLLNEGYSPSRKAGEIDNRGSHFFLTK
FWAKELSIQSEDADLAATFAPVAEALEAHSDEIADALLAVQGTPADLGGYYQPDDAKTTA
IMRPVASYNNIISSIK
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcatctacactcgcaccgacgaagcaccgcttctcgccacttactctctc
aagcccgtcgttgaggccttcgcctccaccgcaggcattgaggtggagacccgcgacatc
tccctcgcaggccgcatcctctcgcaattccccgaattccttgcggaggaccaaaaggtc
gacgacgcactggcggaactcggcgatcttgccaaaactccggaagcaaacatcatcaag
cttcctaacatctctgcttccgtccctcagctcaaagccgcggttgcagagctgcagtcc
caaggctacaaacttccggattacccagattctccctccactgacgaggaaaaagacatc
cgcacccgctacgacgcagtcaaaggctcggccgtcaacccagtgctccgcgagggcaac
tccgatcgtcgcgcccctatcgccgtgaagaactttgccaagaagcaccctcaccgcatg
ggtgcatggtctgcagattccaagaccaacgtggtcaccatggaaagcaatgacttccgc
cataacgagaagtccgtcatcatgccttccgacgacaccctcaccattaaattggtaacc
gacaacggtgaaaaagttctcaaagaaggacttaaggtcctcaaaggcgaggtcgtagac
ggcaccttcatctctgcccgcgccctcgacgagttcctagcagtgcaggtcaagcgcgcc
aaagatgaaggcgtcctcttctcggcacacctcaaggccaccatgatgaaggtttccgac
cccatcatcttcggccatgtcgtccgcgcctactttgcagacgtgttcgcaacctacggc
gagcagctagaggcagccgggctcaatggcgagaacggccttgccgcgatttactctggt
ttagagtctctccccaatggcgccgagatcaaagcagctttcgatgcagccctcgaatcg
ggtgccgacatcgccatggtcaactccgccaagggcatcactaacctccatgtcccctcc
gacgtcatcattgatgcctccatgccggctatgatccgaacctctggccacatgtggaac
aagaacgatgaagagcaggacaccctggccgtcatccccgattcctcctacgcaggcgtg
taccaaaccgttatcgcagactgcaagaagaacggcgcattcgatccaaccaccatgggc
accgtccccaacgtgggcctgatggcacaaaaagctgaggaatacggctcacacgataag
actttcaagatcgaagctaacggcaccgtacaggttgttaactccgctggtgaagtcctg
attgagcacaacgtagaggccggcgacatttggcgcgcctgccaggccaaggatgcccct
atccaggactgggttaagctggcagttactcgttcacgcttgtccggtatgcccgcagta
ttctggctcgatcctgagcgcgcgcacgaccgcaacctcacgactctcgtggaaaagtat
ctcgccgaccacgacaccgagggactcgacatccgcatcatgagccctgtcgacgccacc
cagttctccatcgaccgcatccgccgtggcgaggacaccatttcagttaccggaaacgtg
ctccgcgactacaacacggatctcttcccaatccttgagctcggcacctccgccaagatg
ctctccgtggttcctctcatggctggcggcggactctttgagacaggcgccggcggatcc
gctccaaagcatgtccaacaacttgtcgaggaaaaccacctccgctgggattcccttggc
gagttcctcgctctagcggagtccctacgccactttgccaataccgaaggcaacaccaag
gccggggtacttgccgatgccctcgaccgcgccaccgaaaccctcctcaacgagggttac
tctccatcgcgcaaagcaggagaaatcgacaaccgcggctcgcacttcttccttaccaag
ttctgggcgaaggaattgtcgattcagtccgaagacgccgaccttgccgccacattcgca
cctgtcgcagaggccttggaggcgcactcggatgaaatcgccgatgcactgctcgcagtt
caaggcacccctgccgatcttggtggctactaccagcccgatgacgccaagaccaccgcg
atcatgcgtcccgtcgctagctacaacaacatcattagttccataaagtag

DBGET integrated database retrieval system