KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02101Help
Entry
CULC22_02101      CDS       T01549                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00564  Glycerophospholipid metabolism
cul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CULC22_02101 (glpD)
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CULC22_02101 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 Thi4 GIDA HI0933_like 3HCDH_N Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEG84806
LinkDB All DBs
Position
complement(2283319..2285040)
Genome map
AA seq 573 aa AA seqDB search
MSMSFNPQGFEQAWDRFGSEDFDVVIIGGGSVGAGAALDAATRGLRTAVVETRDFAAGTS
SRSSKMFHGGLRYLAMLDFKLVAESLHERELNMSVLAPHLVKPLKFIFPLTHRLWERVMM
FGGFTLYDLMGGAKSVPMQKHLTRGGVLKVAPGLRNDAIVGGVRYYDTLVDDARHTMMVL
RTAAHYGAVVRPSTQVVGFDKDASGRIVAAQVRDTDTGAVTTIRGKVFINATGVWNDEVE
KLAGAQGKFSVHASKGIHIVVEKDKLDADAALCFVTEKSVLFVIPWGNYWIIGTTDTDWD
KHLSKPDPAPTRADIDYVLSQVNQRVSRQLGYEDIVGVFSGLRPLLSGKSDATTNLSRNH
AVAVVTPGLVSVAGGKYTTYRVIGKDAVDVALKESKITAPESVTERTPIVGADGYHALVN
QVSMLAAKYGVDEQLITHLLGRYGSLCEQVLAPGLEDRQLLTPVEGAEGYCWAEVLYAVT
HEGALHVEDVLLRRLRVGMEYADRGVGAVDGVARRIAPYLGWDDARVEEEISGFVDRVNA
ELAAEKALTDVEANTIMTTATQTRPNVNLDIEG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtcatttaatcctcagggttttgagcaggcctgggatcgtttcggatcagaa
gacttcgacgttgtcattatcggcggcggctctgtgggtgctggcgcggcgctcgatgcg
gccacgcgaggactccgtaccgccgtggtagagactcgtgactttgctgctggaacctcc
tcgcgatcgtcgaaaatgttccacggcggtttgcgctaccttgcaatgttggatttcaaa
cttgtcgcagagtctctccatgagcgtgaactcaatatgtcggtcttggcgccgcacttg
gtcaaacccttaaagttcattttcccgctgactcatcgactctgggaacgcgtgatgatg
ttcggcggattcacgctttatgacctcatgggcggggcgaaaagcgtgcccatgcaaaag
cacctcactcgtgggggcgtgttaaaagttgctccgggcttgcgcaacgatgccattgtg
ggcggtgttcgttactacgacacccttgttgatgatgctcgccataccatgatggtgctg
cgtactgcagctcattacggtgcggtagtacgtccatcaactcaggtagtgggctttgat
aaggatgcttccggtcggatagtggcggcgcaggtgcgcgatactgataccggcgctgtg
acaacgatccgtggcaaggtgtttatcaacgccacgggtgtgtggaacgacgaggtagaa
aaacttgccggcgctcaaggcaagttctctgtgcatgcctccaagggcattcatatcgtg
gtggagaaggataagctcgacgctgacgcagcactgtgctttgtcacggagaagtcggtg
ttgtttgtgattccgtggggtaattattggattattggcaccacggacaccgattgggac
aagcatttatccaagcctgatcctgctcccacacgtgccgatatcgattatgtgttatca
caggttaatcagcgtgtgagcaggcaattggggtatgaagacatcgtaggggtcttctcc
gggttgcgtccattgctcagtggtaagtctgatgctacgacgaatttgtcgcgtaaccat
gctgtagctgtggtgactccagggctggtttccgtggctggcgggaagtacaccacgtat
cgagtaatcggcaaagacgcagttgatgtggctctcaaggaatctaagattactgctcca
gaatcggtgactgagcgtacacctattgtgggtgctgatggataccatgcgttagtgaac
caggtgtcgatgttggccgctaagtacggggtggatgagcagctaataacccatctgctg
gggcggtatggctcgctatgtgagcaggtattggctccggggctggaagatcggcagctg
ctgactcctgtggagggtgctgaaggctattgctgggcagaggttctgtatgcagtcacc
catgaaggtgccctgcacgtggaagacgtattgttgcgtcgtttgcgcgtgggaatggaa
tatgcagaccgaggcgtgggcgctgtggatggcgtagcgcgacgtattgccccatattta
gggtgggatgacgcacgcgtggaagaagagatttcgggattcgttgatcgtgtaaatgca
gaactagctgcagaaaaagcattaacggatgttgaagcgaacacaattatgaccactgcg
acgcaaactcgccccaacgtaaatctggatattgagggctaa

DBGET integrated database retrieval system