KEGG   Curtobacterium sp. MR_MD2014: NI26_10570Help
Entry
NI26_10570        CDS       T04180                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00020  Citrate cycle (TCA cycle)
cum00190  Oxidative phosphorylation
cum00650  Butanoate metabolism
cum01100  Metabolic pathways
cum01110  Biosynthesis of secondary metabolites
cum01120  Microbial metabolism in diverse environments
cum01130  Biosynthesis of antibiotics
cum01200  Carbon metabolism
Module
cum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cum_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cum_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NI26_10570
   00650 Butanoate metabolism
    NI26_10570
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NI26_10570
Enzymes [BR:cum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NI26_10570
    1.3.5.4  fumarate reductase (quinol)
     NI26_10570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO
Motif
Other DBs
NCBI-ProteinID: AIV40489
UniProt: A0A0N6ZZ08
LinkDB All DBs
Position
2292956..2294749
Genome map
AA seq 597 aa AA seqDB search
MSETTVHHHQHDIVIIGAGGAGMRAAIEAGPKAKTAVISKLYPTRSHTGAAQGGMAAALA
NVEEDSWEWHTFDTIKGGDYLVDQDAAEILAKEAIDAVIDLENMGLPFNRTPEGKIDQRR
FGGHTRDHGKAPVRRACYAADRTGHMILQTLFQNCVKLGVEFHNEFYALDLVMVDVVGDD
GVTRQQPAGVVAFELATGELHVFHAKAVIFATGGFGKMYKTTSNAHTLTGDGVGIVWRQG
LPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYAPTIKDLAPRDIVA
RCMVQEVAEGRGAGPNKDYVLLDCTHLGAEVLETKLPDITEFARTYLGVDPVVEPVPVMP
TAHYAMGGIPTNTNAEVLYDNTTVVPGLYAAGECACVSVHGSNRLGTNSLLDINVFGKRS
GNNAAEWVQTAEFLPLPEDPAAGVRGMLDQLRASTGTERIAVLRKELQDEMDKNAQVFRT
DESLGKMTETIHQLRERYLNIAVQDKGKRFNTDLLEAVELGFLLDLAEVVVFSARNRKES
RGGHMRDDYPKRDDENYMQHTMAYLTGDPHSSLADDHITLDWKPVVVTRYEPMERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagaccaccgtccaccaccaccagcacgacatcgtcatcatcggcgcgggcggt
gccggcatgcgtgccgccatcgaagccggcccgaaggcgaagacggccgtcatctcgaag
ctctacccgacgcgctcgcacaccggtgcggcccagggcggcatggctgcggccctggcc
aacgtcgaggaggactcgtgggagtggcacaccttcgacacgatcaagggcggtgactac
ctggtcgaccaggacgccgccgagatcctggcgaaggaggcgatcgacgccgtcatcgac
ctcgagaacatgggcctgccgttcaaccgcacgcccgagggcaagatcgaccagcggcgc
ttcggtgggcacacgcgtgaccacggcaaggcccccgtccgccgggcctgctacgcggcc
gaccgcacgggccacatgatcctgcagacgctgttccagaactgcgtcaagctcggcgtg
gagttccacaacgagttctacgcgctggacctcgtcatggtcgacgtcgtcggcgacgac
ggggtcacccgccagcagcccgccggcgtcgtcgccttcgagctcgcgaccggtgaactg
cacgtcttccacgccaaggccgtgatcttcgcgaccggcggcttcggcaagatgtacaag
acgacctcgaacgcgcacaccctgaccggtgacggcgtcggcatcgtctggcgccagggt
ctgccgctcgaggacatggagttcttccagttccacccgaccggcctcgccggcctcggc
atcctgctcaccgagggtgcccgcggcgagggcgcgatcctccgcaacgcctcgggcgag
cgcttcatggagcggtacgccccgaccatcaaggacctcgcgccccgcgacatcgtcgcc
cggtgcatggtgcaggaggtcgccgaggggcgcggggccggtccgaacaaggactacgtc
ctcctcgactgcacccacctcggtgccgaggtgctcgagacgaagctgccggacatcacc
gagttcgcccgcacctacctcggtgtcgacccggtcgtcgagccggtgccggtcatgccg
accgcgcactacgcgatgggcggcatcccgacgaacaccaacgccgaggtgctctacgac
aacaccacggtcgtgcccggcctgtacgccgccggcgagtgcgcctgcgtgtccgtgcac
ggctcgaaccgcctcggcaccaactcgctgctcgacatcaacgtcttcggcaagcgctcg
ggcaacaacgcggccgagtgggtgcagaccgccgagttcctccccctgcccgaggacccg
gccgccggcgtccgcgggatgctcgaccagctccgcgcctcgaccgggaccgagcgcatc
gccgtcctccgcaaggagctgcaggacgagatggacaagaacgcgcaggtgttccgcacc
gacgagtcgctcggcaagatgaccgagacgatccaccagctccgcgagcggtacctgaac
atcgccgtgcaggacaagggcaagcgcttcaacaccgacctgctcgaggccgtcgaactc
gggttcctgctcgacctggccgaggtggtcgtgttctccgcgcggaaccgcaaggagagt
cgaggcggccacatgcgcgacgactacccgaagcgcgacgacgagaactacatgcagcac
accatggcgtacctgacgggcgacccgcactcgtcactcgccgacgaccacatcacactc
gactggaagcccgtcgtcgtgacgcggtacgagccgatggagaggaagtactga

DBGET integrated database retrieval system