KEGG   Curtobacterium sp. MR_MD2014: NI26_10575Help
Entry
NI26_10575        CDS       T04180                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00020  Citrate cycle (TCA cycle)
cum00190  Oxidative phosphorylation
cum00650  Butanoate metabolism
cum01100  Metabolic pathways
cum01110  Biosynthesis of secondary metabolites
cum01120  Microbial metabolism in diverse environments
cum01130  Biosynthesis of antibiotics
cum01200  Carbon metabolism
Module
cum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cum_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cum_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NI26_10575
   00650 Butanoate metabolism
    NI26_10575
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NI26_10575
Enzymes [BR:cum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NI26_10575
    1.3.5.4  fumarate reductase (quinol)
     NI26_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_4 Fer4_6 Fer4_18 Fer4_2 Fer4_15 Fer4_21 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AIV40490
UniProt: A0A0N6ZZ18
LinkDB All DBs
Position
2294749..2295522
Genome map
AA seq 257 aa AA seqDB search
MTDTLVSDSPRTDTVQSAPPGSFPVTIIVRRFDPDVDDEPRWQDFDVMMLPTDRILDALH
QIKWEQDGSLTFRRSCAHGVCGSDAMRINGRNRLACKTLIKDLDVSKPIYVEAIKGLPLE
KDLVVDMEPFFQSYREVQPFLQASSKPEKGKERVQSVADRARFDDTTKCILCAACTSSCP
VFWTDGQYFGPAAIVNAHRFIFDSRDDSANVRLDILNDKEGVWRCRTTFNCTDACPRGIQ
VTKAISEVKQAIMRGGV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccctggtctccgacagcccgcgcaccgacaccgtgcagagcgctcctccc
ggatcgttccccgtcacgatcatcgtccgccggttcgacccggacgtcgacgacgagccg
cgctggcaggacttcgacgtgatgatgctgccgacggaccgcatcctcgacgccctgcac
cagatcaagtgggagcaggacggctcgctcacgttccggcggtcctgcgcgcacggcgtg
tgcggctcggacgcgatgcgcatcaacgggcgcaaccggctcgcgtgcaagaccctgatc
aaggacctcgacgtgtcgaagccgatctacgtcgaggcgatcaagggcctgccgctcgag
aaggacctggtcgtggacatggagccgttcttccagtcctaccgcgaggtccagccgttc
ctgcaggcctcgagcaagccggaaaagggcaaggagcgcgtgcagtccgtcgccgaccgc
gcccggttcgacgacaccacgaagtgcatcctctgcgccgcgtgcacctcgtcgtgcccc
gtgttctggaccgacgggcagtacttcggcccggcggcgatcgtcaacgcacaccgcttc
atcttcgactcgcgcgacgactcggcgaacgtgcgcctcgacatcctcaacgacaaggag
ggcgtgtggcggtgccgcaccaccttcaactgcaccgacgcctgcccgcgcggcatccag
gtgacgaaggcgatctccgaggtcaagcaggcgatcatgcgcggcggcgtgtga

DBGET integrated database retrieval system